mGluR8 Antibody

Immunohistochemistry-Paraffin: metabotropic Glutamate Receptor 8 Antibody [NBP2-14073] Staining of human kidney shows distinct cytoplasmic and extracellular positivity.

Product Discontinued

mGluR8 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: STEYKVIGHWTNQLHLKVEDMQWAHREHTHPASVCSL
• Predicted Species: Mouse (95%), Rat (95%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GRM8
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for mGluR8 Antibody

• FLJ41058
• glutamate metabotropic receptor 8
• glutamate receptor, metabotropic 8
• GPRC1H
• GPRC1HMGLUR8GLUR8
• GRM8
• metabotropic glutamate receptor 8
• MGC126724
• mGlu8
• mGluR8

Background

The mGluR proteins (metabotropic glutamate receptors) are members of the G protein-coupled receptor family and are functionally and pharmacologically distinct from the GluR proteins (ionotropic glutamate receptors). The eight currently known mGluR proteins are mediated by two G proteins with opposing regulation of adenylate cyclase pathways. The activities of mGluR1 and mGluR5 are mediated by a G protein that activates a phosphatidylinositolcalcium second messenger system and generates a calcium-activated chloride current. The remainder of the eight subtypes of mGluR have an activity mediated by a G protein that inhibits adenylate cyclase activity. GLuR-8 is a group III metabotropic glutamate receptor. In response to glutamate stimulation, GLuR-8 activates GTP-binding proteins that modulate second-messenger cascades. Alternative splicing of this integral membrane protein produces three isoforms: a, b and c. Human GLuR-8 maps to q31.3-q32.1 of chromosome 7.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GRM8