mGluR8 Antibody

Images

 
Immunohistochemistry-Paraffin: metabotropic Glutamate Receptor 8 Antibody [NBP2-14073] Staining of human kidney shows distinct cytoplasmic and extracellular positivity.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

mGluR8 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: STEYKVIGHWTNQLHLKVEDMQWAHREHTHPASVCSL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GRM8
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
MGLUR8 Protein (NBP2-14073PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for mGluR8 Antibody

  • FLJ41058
  • glutamate metabotropic receptor 8
  • glutamate receptor, metabotropic 8
  • GPRC1H
  • GPRC1HMGLUR8GLUR8
  • GRM8
  • metabotropic glutamate receptor 8
  • MGC126724
  • mGlu8
  • mGluR8

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF7387
Species: Hu
Applications: Flow, IHC, CyTOF-ready
NLS921
Species: Hu, Bv
Applications: WB, IHC-P, ICC
NB300-124
Species: Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr
NB110-39033
Species: Hu, Mu, Rt, Ch
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
MAB4514
Species: Hu
Applications: WB, CyTOF-ready, ICFlow
NB300-189
Species: Mu, Rt
Applications: WB, ICC/IF, IHC-Fr
NLS3208
Species: Hu, Po, Bv, Eq, Mk, Pm
Applications: WB, IHC-P, ICC
NBP1-89483
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89489
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF2180
Species: Hu
Applications: WB, Simple Western, IP
NB110-41404
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC
NBP1-80886
Species: Hu
Applications: WB, IHC, IHC-P
NB300-118
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC-Fr, IHC-P, IP, IF
NBP2-33903
Species: Hu
Applications: IHC, IHC-P
NBP2-46627
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-90944
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-45856
Species: Hu
Applications: WB, IHC, IF

Publications for mGluR8 Antibody (NBP2-14073) (0)

There are no publications for mGluR8 Antibody (NBP2-14073).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for mGluR8 Antibody (NBP2-14073) (0)

There are no reviews for mGluR8 Antibody (NBP2-14073). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for mGluR8 Antibody (NBP2-14073) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional mGluR8 Products

Bioinformatics Tool for mGluR8 Antibody (NBP2-14073)

Discover related pathways, diseases and genes to mGluR8 Antibody (NBP2-14073). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for mGluR8 Antibody (NBP2-14073)

Discover more about diseases related to mGluR8 Antibody (NBP2-14073).
 

Pathways for mGluR8 Antibody (NBP2-14073)

View related products by pathway.

PTMs for mGluR8 Antibody (NBP2-14073)

Learn more about PTMs related to mGluR8 Antibody (NBP2-14073).
 

Research Areas for mGluR8 Antibody (NBP2-14073)

Find related products by research area.

Blogs on mGluR8

There are no specific blogs for mGluR8, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our mGluR8 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GRM8
Entrez