MGAT2 Antibody


Western Blot: MGAT2 Antibody [NBP1-69335] - This Anti-MGAT2 antibody was used in Western Blot of Jurkat tissue lysate at a concentration of 1.25ug/ml.
Immunohistochemistry-Paraffin: MGAT2 Antibody [NBP1-69335] - Human kidney.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

MGAT2 Antibody Summary

Synthetic peptides corresponding to MGAT2(mannosyl (alpha-1,6-)-glycoprotein beta-1,2-N-acetylglucosaminyltransferase) The peptide sequence was selected from the middle region of MGAT2. Peptide sequence PKNAALKLGCINAEYPDSFGHYREAKFSQTKHHWWW
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Theoretical MW
51 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Protein A purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for MGAT2 Antibody

  • alpha-1,6-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase
  • Beta-1,2-N-acetylglucosaminyltransferase II
  • CDG2A
  • EC
  • GlcNAc-T II
  • GNT2
  • Mannoside acetylglucosaminyltransferase 2
  • mannosyl (alpha-1,6-)-glycoprotein beta-1,2-N-acetylglucosaminyltransferase
  • N-glycosyl-oligosaccharide-glycoprotein N-acetylglucosaminyltransferase II
  • UDP-N-acetylglucosamine:alpha-6-D-mannosidebeta-1,2-N-acetylglucosaminyltransferase II


MGAT2 is a Golgi enzyme catalyzing an essential step in the conversion of oligomannose to complex N-glycans. The enzyme has the typical glycosyltransferase domains: a short N-terminal cytoplasmic domain, a hydrophobic non-cleavable signal-anchor domain, and a C-terminal catalytic domain. Mutations in its gene may lead to carbohydrate-deficient glycoprotein syndrome, type II.The product of this gene is a Golgi enzyme catalyzing an essential step in the conversion of oligomannose to complex N-glycans. The enzyme has the typical glycosyltransferase domains: a short N-terminal cytoplasmic domain, a hydrophobic non-cleavable signal-anchor domain, and a C-terminal catalytic domain. Mutations in this gene may lead to carbohydrate-deficient glycoprotein syndrome, type II. Two transcript variants encoding the same protein have been identified for this gene.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt, Bv, Ze
Applications: WB, ICC/IF
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu, Mu
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, IHC
Species: Hu, Mu, Rt
Applications: WB, Flow
Species: Hu
Applications: IHC
Species: Hu
Applications: WB, ICC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P

Publications for MGAT2 Antibody (NBP1-69335) (0)

There are no publications for MGAT2 Antibody (NBP1-69335).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MGAT2 Antibody (NBP1-69335) (0)

There are no reviews for MGAT2 Antibody (NBP1-69335). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MGAT2 Antibody (NBP1-69335) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for MGAT2 Antibody (NBP1-69335)

Discover related pathways, diseases and genes to MGAT2 Antibody (NBP1-69335). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MGAT2 Antibody (NBP1-69335)

Discover more about diseases related to MGAT2 Antibody (NBP1-69335).

Pathways for MGAT2 Antibody (NBP1-69335)

View related products by pathway.

PTMs for MGAT2 Antibody (NBP1-69335)

Learn more about PTMs related to MGAT2 Antibody (NBP1-69335).

Blogs on MGAT2

There are no specific blogs for MGAT2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our MGAT2 Antibody and receive a gift card or discount.


Gene Symbol MGAT2