MGA Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: MGA Antibody [NBP2-55033] - Staining of human cell line HeLa shows localization to nucleoplasm & cytosol. Antibody staining is shown in green.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MGA Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LGVQLPLAPATSFPFWNLTGTNPASPDAGFPFVSRTGKTNDFTKIKGWRGKFHSASASRNEGGNSESSLKNRSAFCSD
Specificity
Specificity of human MGA antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MGA
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MGA Recombinant Protein Antigen (NBP2-55033PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for MGA Antibody

  • FLJ12634
  • KIAA0518
  • MAD5
  • MAX dimerization protein 5
  • MAX gene associated
  • MAX gene-associated protein
  • MXD5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-58268
Species: Hu
Applications: WB, IHC, IHC-P
H00008458-M06
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP, KD
H00201780-P01
Species: Hu
AF5415
Species: Hu
Applications: WB, IHC, ICC
NBP2-38770
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-47704
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-41211
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00005555-P01
Species: Hu
NBP1-51671
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-30027
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00004149-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, PLA
H00004154-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NB100-64843
Species: Mu
Applications: Flow, IHC, IHC-Fr, IHC-P
NBP2-55033
Species: Hu, Mu, Rt
Applications: ICC/IF

Publications for MGA Antibody (NBP2-55033) (0)

There are no publications for MGA Antibody (NBP2-55033).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MGA Antibody (NBP2-55033) (0)

There are no reviews for MGA Antibody (NBP2-55033). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for MGA Antibody (NBP2-55033) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Array NBP2-55033

Bioinformatics Tool for MGA Antibody (NBP2-55033)

Discover related pathways, diseases and genes to MGA Antibody (NBP2-55033). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MGA Antibody (NBP2-55033)

Discover more about diseases related to MGA Antibody (NBP2-55033).
 

Pathways for MGA Antibody (NBP2-55033)

View related products by pathway.

PTMs for MGA Antibody (NBP2-55033)

Learn more about PTMs related to MGA Antibody (NBP2-55033).

Blogs on MGA

There are no specific blogs for MGA, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MGA Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MGA