MGA Antibody


Immunocytochemistry/ Immunofluorescence: MGA Antibody [NBP2-55033] - Staining of human cell line HeLa shows localization to nucleoplasm & cytosol. Antibody staining is shown in green.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF

Order Details

MGA Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LGVQLPLAPATSFPFWNLTGTNPASPDAGFPFVSRTGKTNDFTKIKGWRGKFHSASASRNEGGNSESSLKNRSAFCSD
Specificity of human MGA antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (95%). Backed by our 100% Guarantee.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MGA Recombinant Protein Antigen (NBP2-55033PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for MGA Antibody

  • FLJ12634
  • KIAA0518
  • MAD5
  • MAX dimerization protein 5
  • MAX gene associated
  • MAX gene-associated protein
  • MXD5


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP, KD
Species: Hu
Species: Hu
Applications: WB, IHC, ICC
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, PLA
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Mu
Applications: Flow, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF

Publications for MGA Antibody (NBP2-55033) (0)

There are no publications for MGA Antibody (NBP2-55033).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MGA Antibody (NBP2-55033) (0)

There are no reviews for MGA Antibody (NBP2-55033). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for MGA Antibody (NBP2-55033) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Array NBP2-55033

Bioinformatics Tool for MGA Antibody (NBP2-55033)

Discover related pathways, diseases and genes to MGA Antibody (NBP2-55033). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MGA Antibody (NBP2-55033)

Discover more about diseases related to MGA Antibody (NBP2-55033).

Pathways for MGA Antibody (NBP2-55033)

View related products by pathway.

PTMs for MGA Antibody (NBP2-55033)

Learn more about PTMs related to MGA Antibody (NBP2-55033).

Blogs on MGA

There are no specific blogs for MGA, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our MGA Antibody and receive a gift card or discount.


Gene Symbol MGA