Mesothelin Antibody (5R9H8) Summary
| Description |
Novus Biologicals Rabbit Mesothelin Antibody (5R9H8) (NBP3-16777) is a recombinant monoclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Additional Information |
Recombinant Monoclonal Antibody |
| Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 500-600 of human Mesothelin (Q13421). YFVKIQSFLGGAPTEDLKALSQQNVSMDLATFMKLRTDAVLPLTVAEVQKLLGPHVEGLKAEERHRPVRDWILRQRQDDLDTLGLGLQGGIPNGYLVLDLS |
| Source |
HEK293 |
| Isotype |
IgG |
| Clonality |
Monoclonal |
| Host |
Rabbit |
| Gene |
MSLN |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
- Immunohistochemistry
- Western Blot 1:500 - 1:1000
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol, 0.05% BSA |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for Mesothelin Antibody (5R9H8)
Background
MSLN, also known as Mesothelin, has 4 isoforms, a 630 amino acid isoform that is 69 kDa, a 622 amino acid isoform that is 68 kDa, a 656 amino acid isoform that is 71 kDa, and a 621 amino acid isoform that is 68 kDa, expressed in lung, heart, placenta kidney, and overexpressed in mesotheliomas, ovarian cancers, and some squamous cell carcinomas. Membrane-anchored forms may play a role in cellular adhesion and megakaryocyte-potentiating factor (MPF) potentiates megakaryocyte colony formation in vitro. Current research is being performed on several diseases and disorders including squamous cell carcinoma, ovarian cancer, carcinoma, malignant biphasic mesothelioma, bile duct adenoma, malignant mesothelioma, malignant pleural mesothelioma, gastrointestinal stromal tumor, renal clear cell carcinoma, epithelioid sarcoma, benign mesothelioma, pancreatic ductal adenocarcinoma, asbestosis, pancreatic ductal carcinoma, thymic carcinoma, acute myeloid leukemia, epithelial ovarian cancer, myeloid leukemia, thoracic cancer, and pancreatitis. This protein has also shown an interaction with MUC16 and RSG1 in cell adhesion and pancreas development processes and pathways.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: IHC, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, IHC, Neut, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: Bind
Species: Ch, Dr, Fi, Hu, Mar, Mu, Po, Pm, Rb, Rt, Ye, Ze
Applications: ChIP, ChIP, ELISA, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Rt
Applications: WB, ICC/IF, IHC
Publications for Mesothelin Antibody (NBP3-16777) (0)
There are no publications for Mesothelin Antibody (NBP3-16777).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Mesothelin Antibody (NBP3-16777) (0)
There are no reviews for Mesothelin Antibody (NBP3-16777).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Mesothelin Antibody (NBP3-16777) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Mesothelin Products
Research Areas for Mesothelin Antibody (NBP3-16777)
Find related products by research area.
|
Blogs on Mesothelin