MOS Antibody

Images

 
Western Blot: MOS Antibody [NBP1-86241] - Analysis in control (vector only transfected HEK293T lysate) and MOS over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: MOS Antibody [NBP1-86241] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MOS Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: CKISDFGCSEKLEDLLCFQTPSYPLGGTYTHRAPELLKGEGVTPKADIYSFAITLWQMTTKQAPYSGERQHILYAVVAYDLRPSLSAAVF
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MOS
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
MOS Protein (NBP1-86241PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MOS Antibody

  • c-mos
  • EC 2.7.11
  • EC 2.7.11.1
  • MGC119962
  • MGC119963
  • MSV
  • oncogene MOS, Moloney murine sarcoma virus
  • Oocyte maturation factor mos
  • Proto-oncogene c-Mos
  • proto-oncogene serine/threonine-protein kinase mos
  • v-mos Moloney murine sarcoma viral oncogene homolog

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-302
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
NBP2-79724
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, PA
NBP1-85729
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-13304
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
MAB4540
Species: Hu, Mu, Rt
Applications: IHC, WB
NBP2-50037
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
NBP2-67360
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, KO, WB
AF2685
Species: Hu
Applications: IHC, Simple Western, WB
NBP2-33466
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP2-42864
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP1-82956
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-67358
Species: Bv, Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
AF5414
Species: Hu
Applications: Simple Western, WB
7954-GM/CF
Species: Hu
Applications: BA
NBP2-42388
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
AF6000
Species: Hu, Mu
Applications: IHC, Simple Western, WB
NBP1-86241
Species: Hu
Applications: WB, IHC, IHC-P

Publications for MOS Antibody (NBP1-86241) (0)

There are no publications for MOS Antibody (NBP1-86241).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MOS Antibody (NBP1-86241) (0)

There are no reviews for MOS Antibody (NBP1-86241). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MOS Antibody (NBP1-86241) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MOS Products

Bioinformatics Tool for MOS Antibody (NBP1-86241)

Discover related pathways, diseases and genes to MOS Antibody (NBP1-86241). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MOS Antibody (NBP1-86241)

Discover more about diseases related to MOS Antibody (NBP1-86241).
 

Pathways for MOS Antibody (NBP1-86241)

View related products by pathway.

PTMs for MOS Antibody (NBP1-86241)

Learn more about PTMs related to MOS Antibody (NBP1-86241).
 

Research Areas for MOS Antibody (NBP1-86241)

Find related products by research area.

Blogs on MOS

There are no specific blogs for MOS, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MOS Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MOS