Melusin/ITGB1BP2 Antibody

Images

 
Western Blot: Melusin/ITGB1BP2 Antibody [NBP1-55149] - Titration: 2.5ug/ml Positive Control: Human heart.
Immunohistochemistry-Paraffin: Melusin/ITGB1BP2 Antibody [NBP1-55149] - Human Muscle Tissue, Skeletal muscle cells (Indicated with Arrows) 4-8ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Melusin/ITGB1BP2 Antibody Summary

Immunogen
Synthetic peptides corresponding to ITGB1BP2(integrin beta 1 binding protein (melusin) 2) The peptide sequence was selected from the N terminal of ITGB1BP2. Peptide sequence MSLLCRNKGCGQHFDPNTNLPDSCCHHPGVPIFHDALKGWSCCRKRTVDF.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ITGB1BP2
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against ITGB1BP2 and was validated on Western Blot and immunohistochemistry-P
Theoretical MW
38 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Melusin/ITGB1BP2 Antibody

  • CHORDC3
  • integrin beta 1 binding protein (melusin) 2
  • integrin beta-1-binding protein 2
  • ITGB1BP
  • ITGB1BP2
  • Melusin
  • MGC119214

Background

ITGB1BP2 may play a role during maturation and/or organization of muscles cells.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-45923
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38518
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-91865
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-78304
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-47279
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IF
NBP2-33278
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-36561
Species: Hu, Mu
Applications: WB, B/N, ELISA, Flow, ICC/IF, IHC-Fr, IP
NBP1-06529
Species: Hu
Applications: WB, IHC-P, IP, PLA
NB120-2928
Species: Hu, Mu, Rt, Pm, Rb, Sh
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-47833
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB200-610
Species: Hu, Ca, GP
Applications: Flow, ICC/IF, IHC, IHC-Fr, IP
NB600-1293
Species: Hu, Mu, Rt, Am, Bv, Ca, Ch, Tr
Applications: WB, ICC/IF, IHC, IHC-Fr
NBP2-00555
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-33736
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NB100-56655
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for Melusin/ITGB1BP2 Antibody (NBP1-55149) (0)

There are no publications for Melusin/ITGB1BP2 Antibody (NBP1-55149).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Melusin/ITGB1BP2 Antibody (NBP1-55149) (0)

There are no reviews for Melusin/ITGB1BP2 Antibody (NBP1-55149). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Melusin/ITGB1BP2 Antibody (NBP1-55149) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Melusin/ITGB1BP2 Products

Bioinformatics Tool for Melusin/ITGB1BP2 Antibody (NBP1-55149)

Discover related pathways, diseases and genes to Melusin/ITGB1BP2 Antibody (NBP1-55149). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Melusin/ITGB1BP2 Antibody (NBP1-55149)

Discover more about diseases related to Melusin/ITGB1BP2 Antibody (NBP1-55149).
 

Pathways for Melusin/ITGB1BP2 Antibody (NBP1-55149)

View related products by pathway.

PTMs for Melusin/ITGB1BP2 Antibody (NBP1-55149)

Learn more about PTMs related to Melusin/ITGB1BP2 Antibody (NBP1-55149).
 

Research Areas for Melusin/ITGB1BP2 Antibody (NBP1-55149)

Find related products by research area.

Blogs on Melusin/ITGB1BP2

There are no specific blogs for Melusin/ITGB1BP2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Melusin/ITGB1BP2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ITGB1BP2
Entrez
Uniprot