MEF2D Antibody (3A11)

Images

 
Western Blot: MEF2D Antibody (3A11) [H00004209-M02] - MEF2D monoclonal antibody (M02), clone 3A11 Analysis of MEF2D expression in K-562.
Immunocytochemistry/ Immunofluorescence: MEF2D Antibody (3A11) [H00004209-M02] - Analysis of monoclonal antibody to MEF2D on HeLa cell. Antibody concentration 10 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
3A11
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

MEF2D Antibody (3A11) Summary

Immunogen
MEF2D (NP_005911.1 256 a.a. - 351 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. THSTQLGAPSRKPDLRVITSQAGKGLMHHLTEDHLDLNNAQRLGVSQSTHSLTTPVVSVATPSLLSQGLPFSSMPTAYNTDYQLTSAELSSLPAFS
Specificity
MEF2D (3A11)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
MEF2D
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MEF2D Antibody (3A11)

  • DKFZp686I1536
  • MADS box transcription enhancer factor 2, polypeptide D (myocyte enhancerfactor 2D)
  • MEF2D/DAZAP1 fusion
  • myocyte enhancer factor 2D
  • myocyte enhancer factor 2D/deleted in azoospermia associated protein 1 fusionprotein
  • myocyte-specific enhancer factor 2D

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00004205-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-00493
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-49533
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-03993
Species: Hu, Bv, Ca, Pm
Applications: WB, IHC, IHC-P
NB100-56341
Species: Hu
Applications: WB, ChIP, IP
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-93440
Species: Hu
Applications: IHC, IHC-P
AF2848
Species: Hu, Mu
Applications: WB, ICC
NBP2-15843
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56511
Species: Hu, Mu, Rt, Fe
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
NB100-56510
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB100-56745
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IP
NBP1-87789
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-22152
Species: Hu, Mu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-47470
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
AF2850
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC
NBP2-22127
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P

Publications for MEF2D Antibody (H00004209-M02) (0)

There are no publications for MEF2D Antibody (H00004209-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MEF2D Antibody (H00004209-M02) (0)

There are no reviews for MEF2D Antibody (H00004209-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MEF2D Antibody (H00004209-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MEF2D Products

Bioinformatics Tool for MEF2D Antibody (H00004209-M02)

Discover related pathways, diseases and genes to MEF2D Antibody (H00004209-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MEF2D Antibody (H00004209-M02)

Discover more about diseases related to MEF2D Antibody (H00004209-M02).
 

Pathways for MEF2D Antibody (H00004209-M02)

View related products by pathway.

PTMs for MEF2D Antibody (H00004209-M02)

Learn more about PTMs related to MEF2D Antibody (H00004209-M02).

Blogs on MEF2D

There are no specific blogs for MEF2D, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MEF2D Antibody (3A11) and receive a gift card or discount.

Bioinformatics

Gene Symbol MEF2D
Entrez
OMIM
Uniprot