mediator of cell motility 1 Antibody

Images

 
Immunohistochemistry-Paraffin: mediator of cell motility 1 Antibody [NBP1-88269] - Staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

mediator of cell motility 1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:FILGPSHHVPLSRCALSSVDIYRTPLYDLRIDQKIYGELWKTGMFERMSLQTDEDEHSIEMHLPYTAK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MEMO1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
mediator of cell motility 1 Protein (NBP1-88269PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for mediator of cell motility 1 Antibody

  • C21orf19-like protein
  • C2orf4DKFZp434I0135
  • CGI-27
  • FLJ25031
  • HCV NS5A-transactivated protein 7
  • Hepatitis C virus NS5A-transactivated protein 7
  • mediator of cell motility 1
  • Mediator of ErbB2-driven cell motility 1
  • memo-1
  • MEMOchromosome 2 open reading frame 4
  • NS5ATP7
  • protein MEMO1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB500-317
Species: Hu, Bv(-), Ca(-), Ch(-), Mu(-), Rb(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, RIA
NBP1-89942
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
H00005725-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-21395
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IP
NBP2-13674
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-02623
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-91499
Species: Mu, Bv
Applications: WB, ICC/IF, IHC
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
H00006934-M06
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NB100-91273
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB600-230
Species: Hu
Applications: WB
H00023499-M08
Species: Hu
Applications: WB, ELISA
NBP1-88269
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for mediator of cell motility 1 Antibody (NBP1-88269) (0)

There are no publications for mediator of cell motility 1 Antibody (NBP1-88269).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for mediator of cell motility 1 Antibody (NBP1-88269) (0)

There are no reviews for mediator of cell motility 1 Antibody (NBP1-88269). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for mediator of cell motility 1 Antibody (NBP1-88269) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional mediator of cell motility 1 Products

Bioinformatics Tool for mediator of cell motility 1 Antibody (NBP1-88269)

Discover related pathways, diseases and genes to mediator of cell motility 1 Antibody (NBP1-88269). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for mediator of cell motility 1 Antibody (NBP1-88269)

Discover more about diseases related to mediator of cell motility 1 Antibody (NBP1-88269).
 

Pathways for mediator of cell motility 1 Antibody (NBP1-88269)

View related products by pathway.

PTMs for mediator of cell motility 1 Antibody (NBP1-88269)

Learn more about PTMs related to mediator of cell motility 1 Antibody (NBP1-88269).

Blogs on mediator of cell motility 1

There are no specific blogs for mediator of cell motility 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our mediator of cell motility 1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MEMO1