mediator of cell motility 1 Antibody - BSA Free

Western Blot: LOC100047915 Antibody [NBP1-74243] - Mouse Kidney Lysate 1ug/ml Gel Concentration 12%

• Reactivity: Mu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

mediator of cell motility 1 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to the N terminal of LOC100047915. Immunizing peptide sequence SGPQLNAQLEGWLSQVQSTKRPARAIIAPHAGYTYCGSCAAHAYKQVDPS. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MEMO1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for mediator of cell motility 1 Antibody - BSA Free

• C21orf19-like protein
• C2orf4DKFZp434I0135
• CGI-27
• FLJ25031
• HCV NS5A-transactivated protein 7
• Hepatitis C virus NS5A-transactivated protein 7
• mediator of cell motility 1
• Mediator of ErbB2-driven cell motility 1
• memo-1
• MEMOchromosome 2 open reading frame 4
• NS5ATP7
• protein MEMO1

Background

MEMO1 (Mediator of ErbB2-driven cell motility 1) is a 297 amino acid protein. It is thought to relax extracellular chemotactic signals that are targeted at the microtubule cytoskeleton, thereby controlling cell migration. Additionally, MEMO1 is required for breast carcinoma migration, suggesting an important role in tumorigenesis. The MEMO1-RHOA-DIAPH1 signaling pathway plays an important role in ERBB2-dependent stabilization of microtubules at the cell cortex. It controls the localization of APC and CLASP2 to the cell membrane, via the regulation of GSK3B activity

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MEMO1