MED31 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: MED31 Antibody [NBP1-84519] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: MED31 Antibody [NBP1-84519] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MED31 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:AAAVAMETDDAGNRLRFQLELEFVQCLANPNYLNFLAQRGYFKDKAFVNYLKYLLYWKDPEYAKYLKYPQC
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MED31
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MED31 Protein (NBP1-84519PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MED31 Antibody

  • CGI-125
  • FLJ27436
  • FLJ36714
  • hSOH1
  • mediator complex subunit 313110004H13Rik
  • Mediator complex subunit SOH1
  • mediator of RNA polymerase II transcription subunit 31
  • mediator of RNA polymerase II transcription, subunit 31 homolog (S. cerevisiae)
  • mediator of RNA polymerase II transcription, subunit 31 homolog
  • Soh1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2574
Species: Hu, Mu
Applications: WB, ICC/IF, IHC-P, IP, PLA
H00001024-M03
Species: Hu, Mu, Rt
Applications: WB, ELISA
NBP2-56318
Species: Hu
Applications: ICC/IF
NB100-1774
Species: Hu, Rt, Am, Dr
Applications: WB, EM, ELISA, ICC/IF, IP
NBP2-58707
Species: Hu
Applications: WB, ICC/IF
NBP1-84140
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38118
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF933
Species: Hu
Applications: WB, Simple Western, IHC, IP
NBP1-89670
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-76498
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC
NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P
NBP2-32840
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC-P, IP
NB500-171
Species: Hu, Mu, Rt, Xp, Ye
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NBP1-92271
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
7570-GH
Species: Hu
NB100-1923
Species: Ce
Applications: WB, IHC, IHC-P, IP
NBP1-84519
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for MED31 Antibody (NBP1-84519) (0)

There are no publications for MED31 Antibody (NBP1-84519).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MED31 Antibody (NBP1-84519) (0)

There are no reviews for MED31 Antibody (NBP1-84519). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for MED31 Antibody (NBP1-84519) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MED31 Products

Bioinformatics Tool for MED31 Antibody (NBP1-84519)

Discover related pathways, diseases and genes to MED31 Antibody (NBP1-84519). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MED31 Antibody (NBP1-84519)

Discover more about diseases related to MED31 Antibody (NBP1-84519).
 

Pathways for MED31 Antibody (NBP1-84519)

View related products by pathway.

PTMs for MED31 Antibody (NBP1-84519)

Learn more about PTMs related to MED31 Antibody (NBP1-84519).

Blogs on MED31

There are no specific blogs for MED31, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MED31 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MED31