MED31 Antibody


Immunocytochemistry/ Immunofluorescence: MED31 Antibody [NBP1-84519] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: MED31 Antibody [NBP1-84519] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

MED31 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: AAAVAMETDDAGNRLRFQLELEFVQCLANPNYLNFLAQRGYFKDKAFVNYLKYLLYWKDPEYAKYLKYPQC
Predicted Species
Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MED31 Protein (NBP1-84519PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for MED31 Antibody

  • CGI-125
  • FLJ27436
  • FLJ36714
  • hSOH1
  • mediator complex subunit 313110004H13Rik
  • Mediator complex subunit SOH1
  • mediator of RNA polymerase II transcription subunit 31
  • mediator of RNA polymerase II transcription, subunit 31 homolog (S. cerevisiae)
  • mediator of RNA polymerase II transcription, subunit 31 homolog
  • Soh1


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB
Species: Hu, Mu, Rt
Applications: IP, KO, WB
Species: Hu
Applications: ChIP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB
Species: Ha, Hu, Mu, Rt
Applications: Block, Flow, IHC, IP, Simple Western, WB
Species: Ha, Hu, Pm, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Bv, Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Ce, Dr, Hu, In, Ma, Mu, Po, Rt, Ye
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: EnzAct
Species: Ce
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for MED31 Antibody (NBP1-84519) (0)

There are no publications for MED31 Antibody (NBP1-84519).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MED31 Antibody (NBP1-84519) (0)

There are no reviews for MED31 Antibody (NBP1-84519). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for MED31 Antibody (NBP1-84519) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional MED31 Products

Bioinformatics Tool for MED31 Antibody (NBP1-84519)

Discover related pathways, diseases and genes to MED31 Antibody (NBP1-84519). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MED31 Antibody (NBP1-84519)

Discover more about diseases related to MED31 Antibody (NBP1-84519).

Pathways for MED31 Antibody (NBP1-84519)

View related products by pathway.

PTMs for MED31 Antibody (NBP1-84519)

Learn more about PTMs related to MED31 Antibody (NBP1-84519).

Blogs on MED31

There are no specific blogs for MED31, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our MED31 Antibody and receive a gift card or discount.


Gene Symbol MED31