MED31 Antibody - BSA Free

Western Blot: MED31 Antibody [NBP1-56861] - Quiescent human colon carcinoma cultures were treated with 10% FBS for three time points (0, 15, 30min) or (0, 30, 60min) were used in Matrix-ChIP and real-time PCR assays at EGR1 gene (Exon1) and 15kb upstream site.

Western Blot: MED31 Antibody [NBP1-56861] - Human Liver cell lysate, concentration 0.2-1 ug/ml.

• Reactivity: Hu
• Applications: WB, ChIP
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

MED31 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to MED31(mediator complex subunit 31) The peptide sequence was selected from the N terminal of MED31. Peptide sequence MAAAVAMETDDAGNRLRFQLELEFVQCLANPNYLNFLAQRGYFKDKAFVN. The peptide sequence for this immunogen was taken from within the described region.
• Specificity: This product is specific to Subunit or Isoform: 31.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MED31
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Chromatin Immunoprecipitation (ChIP) 1:10-1:500
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for MED31 Antibody - BSA Free

• CGI-125
• FLJ27436
• FLJ36714
• hSOH1
• mediator complex subunit 313110004H13Rik
• Mediator complex subunit SOH1
• mediator of RNA polymerase II transcription subunit 31
• mediator of RNA polymerase II transcription, subunit 31 homolog (S. cerevisiae)
• mediator of RNA polymerase II transcription, subunit 31 homolog
• Soh1

Background

MED31 is the component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MED31
• Uniprot:
  • Q9Y3C7(Human)