CDK8 Antibody (5H4)

Images

 
Western Blot: CDK8 Antibody (5H4) [H00001024-M03] - Analysis of CDK8 expression in NIH/3T3 (Cat # L018V1).
Western Blot: CDK8 Antibody (5H4) [H00001024-M03] - Analysis of CDK8 expression in PC-12 (Cat # L012V1).
Western Blot: CDK8 Antibody (5H4) [H00001024-M03] - Analysis of CDK8 expression in Hela S3 NE (Cat # L013V3).
Western Blot: CDK8 Antibody (5H4) [H00001024-M03] - Analysis of CDK8 expression in Raw 264.7 (Cat # L024V1).
Western Blot: CDK8 Antibody (5H4) [H00001024-M03] - Analysis of CDK8 expression in Jurkat (Cat # L017V1).
Western Blot: CDK8 Antibody (5H4) [H00001024-M03] - Analysis of CDK8 expression in K-562 (Cat # L009V1).
ELISA: CDK8 Antibody (5H4) [H00001024-M03] - Detection limit for recombinant GST tagged CDK8 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ELISA
Clone
5H4
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

CDK8 Antibody (5H4) Summary

Immunogen
CDK8 (NP_001251 375 a.a. - 464 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. QQQGNNHTNGTGHPGNQDSSHTQGPPLKKVRVVPPTTTSGGLIMTSDYQRSNPHAAYPNPGPSTSQPQSSMGYSATSQQPPQYSHQTHRY
Localization
Nuclear
Specificity
CDK8 - cyclin-dependent kinase 8
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CDK8
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CDK8 Antibody (5H4)

  • CDK8 protein kinase
  • CDK8
  • Cell division protein kinase 8
  • cyclin-dependent kinase 8
  • EC 2.7.11
  • EC 2.7.11.22
  • EC 2.7.11.23
  • K35
  • Mediator complex subunit CDK8
  • Mediator of RNA polymerase II transcription subunit CDK8
  • MGC126074
  • MGC126075
  • Protein kinase K35

Background

The protein encoded by this gene is a member of the cyclin-dependent protein kinase (CDK) family. CDK family members are highly similar to the gene products of Saccharomyces cerevisiae cdc28, and Schizosaccharomyces pombe cdc2, and are known to be important regulators of cell cycle progression. This kinase and its regulatory subunit cyclin C are components of the RNA polymerase II holoenzyme complex, which phosphorylates the carboxy-terminal domain (CTD) of the largest subunit of RNA polymerase II. This kinase has also been shown to regulate transcription by targeting the CDK7/cyclin H subunits of the general transcription initiation factor IIH (TFIIH), thus providing a link between the 'Mediator-like' protein complexes and the basal transcription machinery.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-18878
Species: Hu
Applications: WB, IHC-P, IP
NB120-10874
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NB100-581
Species: Hu
Applications: WB, IHC, IP, PLA, ICC
NB100-60642
Species: Hu
Applications: WB, IP
NB100-2357
Species: Hu, Mu, Pm
Applications: WB, IHC, IHC-P, IP
H00000902-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NBP2-37507
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NB100-2574
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, PLA
NB200-338
Species: Hu, Mu
Applications: WB (-), IP
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP
AF6349
Species: Hu, Mu, Rt
Applications: WB
NBL1-11392
Species: Hu
H00002968-B01P
Species: Hu
Applications: WB, ICC/IF
NBP2-56841
Species: Hu
Applications: WB, ICC/IF
NBP2-30371
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-38556
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-12933
Species: Hu, Mu, Rt, Po
Applications: WB, PEP-ELISA
NBP1-85729
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00001024-M03
Species: Hu, Mu, Rt
Applications: WB, ELISA

Publications for CDK8 Antibody (H00001024-M03) (0)

There are no publications for CDK8 Antibody (H00001024-M03).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CDK8 Antibody (H00001024-M03) (0)

There are no reviews for CDK8 Antibody (H00001024-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CDK8 Antibody (H00001024-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CDK8 Products

Bioinformatics Tool for CDK8 Antibody (H00001024-M03)

Discover related pathways, diseases and genes to CDK8 Antibody (H00001024-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CDK8 Antibody (H00001024-M03)

Discover more about diseases related to CDK8 Antibody (H00001024-M03).
 

Pathways for CDK8 Antibody (H00001024-M03)

View related products by pathway.

PTMs for CDK8 Antibody (H00001024-M03)

Learn more about PTMs related to CDK8 Antibody (H00001024-M03).
 

Research Areas for CDK8 Antibody (H00001024-M03)

Find related products by research area.

Blogs on CDK8.

Notch1 - A multifunctional transmembrane receptor
Notch1 is a member of the Notch family of Type 1 single-pass transmembrane proteins that share an extracellular domain of multiple epidermal growth factor-like (EGF) repeats. Notch family members play key roles in a variety of developmental process...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CDK8 Antibody (5H4) and receive a gift card or discount.

Bioinformatics

Gene Symbol CDK8
Entrez
OMIM
Uniprot