MED27 Antibody - BSA Free

Western Blot: MED27 Antibody [NBP1-84377] - Analysis in control (vector only transfected HEK293T lysate) and MED27 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunocytochemistry/Immunofluorescence: MED27 Antibody [NBP1-84377] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus, nucleoli & cytosol.

Immunohistochemistry-Paraffin: MED27 Antibody [NBP1-84377] - Staining of human cerebral cortex shows moderate nuclear positivity in neurons and glial cells.

Immunohistochemistry-Paraffin: MED27 Antibody [NBP1-84377] - Staining of human prostate shows moderate nuclear positivity in glandular cells.

Immunohistochemistry-Paraffin: MED27 Antibody [NBP1-84377] - Staining of human testis shows weak to moderate nuclear and cytoplasmic positivity in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: MED27 Antibody [NBP1-84377] - Staining of human endometrium shows moderate nuclear positivity in glandular cells.

ChIP-Exo-Seq composite graph for Anti-MED27 (NBP1-84377) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC, ChIP
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

MED27 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit MED27 Antibody - BSA Free (NBP1-84377) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: KPSENHPLHNSGLLSLDPVQDKTPLYSQLLQAYKWSNKLQYHAGLASGLLNQQSLKRSANQMGVSAKRRPKAQPTTLVLPPQYVDDVISRIDR
• Predicted Species: Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MED27
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Chromatin Immunoprecipitation-exo-Seq
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  MED27 Protein (NBP1-84377PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for MED27 Antibody - BSA Free

• cofactor required for Sp1 transcriptional activation, subunit 8, 34kDa
• CRSP34CRSP complex subunit 8
• CRSP8CRAP34
• mediator complex subunit 27Transcriptional coactivator CRSP34
• mediator of RNA polymerase II transcription subunit 27
• MGC11274
• P37 TRAP/SMCC/PC2 subunit
• subunit 8 (34kD)
• TRAP37

Background

The activation of gene transcription is a multistep process that is triggered by factors that recognize transcriptional enhancer sites in DNA. These factors work with co-activators to direct transcriptional initiation by the RNA polymerase II apparatus. The protein encoded by this gene is a subunit of the CRSP (cofactor required for SP1 activation) complex, which, along with TFIID, is required for efficient activation by SP1. This protein is also a component of other multisubunit complexes e.g. thyroid hormone receptor-(TR-) associated proteins which interact with TR and facilitate TR function on DNA templates in conjunction with initiation factors and cofactors.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MED27