MED27 Antibody

Images

 
Western Blot: MED27 Antibody [NBP1-84377] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunocytochemistry/ Immunofluorescence: MED27 Antibody [NBP1-84377] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus, nucleoli & cytosol.
Immunohistochemistry-Paraffin: MED27 Antibody [NBP1-84377] - Staining of human testis shows moderate cytoplasmic and nuclear positivity in cells in seminiferous ducts and Leydig cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MED27 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:KPSENHPLHNSGLLSLDPVQDKTPLYSQLLQAYKWSNKLQYHAGLASGLLNQQSLKRSANQMGVSAKRRPKAQPTTLVLPPQYVDDVISRIDR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MED27
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MED27 Protein (NBP1-84377PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MED27 Antibody

  • cofactor required for Sp1 transcriptional activation, subunit 8, 34kDa
  • CRSP34CRSP complex subunit 8
  • CRSP8CRAP34
  • mediator complex subunit 27Transcriptional coactivator CRSP34
  • mediator of RNA polymerase II transcription subunit 27
  • MGC11274
  • P37 TRAP/SMCC/PC2 subunit
  • subunit 8 (34kD)
  • TRAP37

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-74599
Species: Hu, Mu
Applications: WB, IP
NBP2-56318
Species: Hu
Applications: ICC/IF
NBP1-87818
Species: Hu
Applications: WB, IHC, IHC-P
H00006334-M04
Species: Hu
Applications: WB, ELISA, ICC/IF
H00055588-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NB100-2574
Species: Hu, Mu
Applications: WB, ICC/IF, IHC-P, IP, PLA
NB100-64779
Species: Hu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P, IP
NBP1-85161
Species: Hu
Applications: IHC, IHC-P
H00001297-T01
Species: Hu
NBP1-18878
Species: Hu
Applications: WB, IHC-P, IP
NB200-598
Species: Hu, Mu, Ye, Pm(-)
Applications: WB, ChIP, ELISA, Flow, ICC/IF, IP, CyTOF-ready, Flow-IC
NB100-2357
Species: Hu, Mu, Pm
Applications: WB, IHC-P, IP
NB100-60642
Species: Hu
Applications: WB, IP
H00009441-M06
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
H00009443-M01
Species: Hu
Applications: WB, ELISA
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
H00006919-B02P
Species: Hu
Applications: WB, ICC/IF
NBP1-88840
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-93707
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-52432
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready, ICC

Publications for MED27 Antibody (NBP1-84377) (0)

There are no publications for MED27 Antibody (NBP1-84377).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MED27 Antibody (NBP1-84377) (0)

There are no reviews for MED27 Antibody (NBP1-84377). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MED27 Antibody (NBP1-84377) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MED27 Products

Bioinformatics Tool for MED27 Antibody (NBP1-84377)

Discover related pathways, diseases and genes to MED27 Antibody (NBP1-84377). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

PTMs for MED27 Antibody (NBP1-84377)

Learn more about PTMs related to MED27 Antibody (NBP1-84377).

Blogs on MED27

There are no specific blogs for MED27, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MED27 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MED27