MECR Antibody

Images

 
Western Blot: MECR Antibody [NBP1-85657] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/ Immunofluorescence: MECR Antibody [NBP1-85657] - Immunofluorescent staining of human cell line A-431 shows localization to mitochondria.
Immunohistochemistry-Paraffin: MECR Antibody [NBP1-85657] - Staining of human breast shows strong cytoplasmic positivity in glandular cells.
Western Blot: MECR Antibody [NBP1-85657] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MECR Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SSTELLRQLARGGTMVTYGGMAKQPVVASVSLLIFKDLKLRGFWLSQWKKDHSPDQFKELILTLCDLIRRGQLTAPACSQVPLQDYQSALEASMKPFISSKQILTM
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MECR
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MECR Protein (NBP1-85657PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MECR Antibody

  • CGI-63
  • EC 1.3.1.38
  • FASN2B
  • homolog of yeast 2-enoyl thioester reductase
  • HsNrbf-1
  • mitochondrial 2-enoyl thioester reductase
  • mitochondrial trans-2-enoyl-CoA reductase
  • NBRF1
  • NRBF-1
  • NRBF1hsNrbf-1
  • nuclear receptor binding factor 1
  • Nuclear receptor-binding factor 1
  • trans-2-enoyl-CoA reductase, mitochondrial

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB400-114
Species: Hu, Mu, Rt, Po, Ch, Ha, Pl, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB120-13550
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB300-537
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
AF5415
Species: Hu
Applications: WB, IHC, ICC
NBP2-38877
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-47883
Species: Hu, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-30078
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-P
H00005688-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
NBP1-81037
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00009617-B01P
Species: Hu
Applications: WB, ELISA
MAB393
Species: Hu
Applications: WB, Simple Western, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NB100-2574
Species: Hu, Mu
Applications: WB, ICC/IF, IHC-P, IP, PLA
AF4538
Species: Hu, Mu, Rt
Applications: WB
NBP2-07799
Species: Hu
AF6270
Species: Hu
Applications: ICC
NBP1-82625
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-47602
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NB110-40760
Species: Hu, Mu, Rt, Po
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85657
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for MECR Antibody (NBP1-85657) (0)

There are no publications for MECR Antibody (NBP1-85657).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MECR Antibody (NBP1-85657) (0)

There are no reviews for MECR Antibody (NBP1-85657). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MECR Antibody (NBP1-85657) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MECR Products

Bioinformatics Tool for MECR Antibody (NBP1-85657)

Discover related pathways, diseases and genes to MECR Antibody (NBP1-85657). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MECR Antibody (NBP1-85657)

Discover more about diseases related to MECR Antibody (NBP1-85657).
 

Pathways for MECR Antibody (NBP1-85657)

View related products by pathway.

PTMs for MECR Antibody (NBP1-85657)

Learn more about PTMs related to MECR Antibody (NBP1-85657).

Blogs on MECR

There are no specific blogs for MECR, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MECR Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MECR