TRIM59 Antibody - BSA Free

Western Blot: TRIM59 Antibody [NBP1-59777] - Titration: 5.0ug/ml Positive Control: Jurkat cell lysate.

Immunohistochemistry-Paraffin: TRIM59 Antibody [NBP1-59777] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.

• Reactivity: Hu
• Applications: WB, IHC, IP
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 1 mg/ml

TRIM59 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to TRIM59(tripartite motif-containing 59) The peptide sequence was selected from the middle region of TRIM59. Peptide sequence LEKVDDVRQHVQILKQRPLPEVQPVEIYPRVSKILKEEWSRTEIGQIKNV. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TRIM59
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Immunoprecipitation
  • Western Blot 1.0 ug/ml
• Application Notes: Use in immunoprecipitation reported in scientific literature (PMID:31875525).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 1 mg/ml
• Purity: Protein A purified

Alternate Names for TRIM59 Antibody - BSA Free

• MGC129860
• MGC129861
• Mrf1
• RING finger protein 104
• RNF104MGC26631
• TRIM57
• tripartite motif containing 59
• tripartite motif-containing 57
• tripartite motif-containing 59
• tripartite motif-containing protein 59
• TSBF1MRF1
• tumor suppressor TSBF1
• Tumor suppressor TSBF-1

Background

Tripartite Motif Containing 59 (human TRIM59 theoretical molecular weight 47 kDa) belongs to a large family of 80 human isoforms. TRIM family members share N-terminal RING finger, one or two B box, and Coiled-Coil domains (CCD). The RING (Really Interesting New Gene) finger domain imparts TRIMs with E3 ubiquitin ligase activity and ability to regulate cell cycle, transcription factor, and signaling genes. TRIMs are involved in different cellular processes including cellular differentiation, senescence, stem cell pluripotency, and control of microbial infections (1). TRIM59 is implicated in a variety of cancer types (e.g., breast, colorectal, ovarian, and esophageal) and its expression serves as a marker of poor prognosis in cancer patients (2,3). Originally cloned from mice and named mouse RING finger 1 (Mrf1), TRIM59 mRNA is predominantly expressed in testis, spleen, brain, and heart tissues (3). TRIMs play a role in the process of autophagy where they serve as receptors, regulatory proteins, and adaptors for core autophagy proteins (e.g., Beclin1, ULK1, and ATG16L1) (1).

1. Kimura, T., Mandell, M., & Deretic, V. (2016). Precision autophagy directed by receptor regulators - emerging examples within the TRIM family. Journal of Cell Science. https://doi.org/10.1242/jcs.163758

2. Wang, M., Chao, C., Luo, G., Wang, B., Zhan, X., Di, D., Qian, Y., & Zhang, X. (2019). Prognostic significance of TRIM59 for cancer patient survival: A systematic review and meta-analysis. Medicine, 98(48), e18024. https://doi.org/10.1097/MD.0000000000018024

3. Mandell, M. A., Saha, B., & Thompson, T. A. (2020). The Tripartite Nexus: Autophagy, Cancer, and Tripartite Motif-Containing Protein Family Members. Frontiers in Pharmacology. https://doi.org/10.3389/fphar.2020.00308

4. Chang, R., Xu, X., & Li, M. D. (2002). Molecular cloning, mapping and characterization of a novel mouse RING finger gene, Mrf1. Gene. https://doi.org/10.1016/S0378-1119(02)00603-0

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for TRIM59 Antibody (NBP1-59777)(4)

Publications using NBP1-59777

• Yang W, Cui X, Sun D et Al. POU5F1 promotes the proliferation, migration, and invasion of gastric cancer cells by reducing the ubiquitination level of TRAF6 Cell Death Dis 2023-12-07 [PMID: 38062041]
• G Wei, C Li, X Jia, J Xie, Z Tang, M Jin, Q Chen, Y Sun, S He, X Li, Y Chen, H Zheng, W Liao, Y Liao, J Bin, S Huang Extracellular vesicle-derived CircWhsc1 Promotes Cardiomyocyte Proliferation and Heart Repair by activating TRIM59/STAT3/Cyclin B2 pathway Journal of advanced research, 2022-12-29;0(0):. 2022-12-29 [PMID: 36587763]
• Zhang J, Xie H, Yao J et al. TRIM59 promotes steatosis and ferroptosis in non-alcoholic fatty liver disease via enhancing GPX4 ubiquitination Human cell 2022-11-22 [PMID: 36417114] (IP, Human)
• Ying H, Ji L, Xu Z, et al. TRIM59 promotes tumor growth in hepatocellular carcinoma and regulates the cell cycle by degradation of protein phosphatase 1B Cancer Lett. 2019-12-22 [PMID: 31875525] (WB, IP, Human)

Bioinformatics

• Gene Symbol: TRIM59
• Uniprot:
  • Q8IWR1(Human)