After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Immunogen
Synthetic peptides corresponding to TRIM59(tripartite motif-containing 59) The peptide sequence was selected from the middle region of TRIM59. Peptide sequence LEKVDDVRQHVQILKQRPLPEVQPVEIYPRVSKILKEEWSRTEIGQIKNV. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TRIM59
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Concentration
1 mg/ml
Purity
Protein A purified
Alternate Names for TRIM59 Antibody - BSA Free
MGC129860
MGC129861
Mrf1
RING finger protein 104
RNF104MGC26631
TRIM57
tripartite motif containing 59
tripartite motif-containing 57
tripartite motif-containing 59
tripartite motif-containing protein 59
TSBF1MRF1
tumor suppressor TSBF1
Tumor suppressor TSBF-1
Background
Tripartite Motif Containing 59 (human TRIM59 theoretical molecular weight 47 kDa) belongs to a large family of 80 human isoforms. TRIM family members share N-terminal RING finger, one or two B box, and Coiled-Coil domains (CCD). The RING (Really Interesting New Gene) finger domain imparts TRIMs with E3 ubiquitin ligase activity and ability to regulate cell cycle, transcription factor, and signaling genes. TRIMs are involved in different cellular processes including cellular differentiation, senescence, stem cell pluripotency, and control of microbial infections (1). TRIM59 is implicated in a variety of cancer types (e.g., breast, colorectal, ovarian, and esophageal) and its expression serves as a marker of poor prognosis in cancer patients (2,3). Originally cloned from mice and named mouse RING finger 1 (Mrf1), TRIM59 mRNA is predominantly expressed in testis, spleen, brain, and heart tissues (3). TRIMs play a role in the process of autophagy where they serve as receptors, regulatory proteins, and adaptors for core autophagy proteins (e.g., Beclin1, ULK1, and ATG16L1) (1).
1. Kimura, T., Mandell, M., & Deretic, V. (2016). Precision autophagy directed by receptor regulators - emerging examples within the TRIM family. Journal of Cell Science. https://doi.org/10.1242/jcs.163758
2. Wang, M., Chao, C., Luo, G., Wang, B., Zhan, X., Di, D., Qian, Y., & Zhang, X. (2019). Prognostic significance of TRIM59 for cancer patient survival: A systematic review and meta-analysis. Medicine, 98(48), e18024. https://doi.org/10.1097/MD.0000000000018024
3. Mandell, M. A., Saha, B., & Thompson, T. A. (2020). The Tripartite Nexus: Autophagy, Cancer, and Tripartite Motif-Containing Protein Family Members. Frontiers in Pharmacology. https://doi.org/10.3389/fphar.2020.00308
4. Chang, R., Xu, X., & Li, M. D. (2002). Molecular cloning, mapping and characterization of a novel mouse RING finger gene, Mrf1. Gene. https://doi.org/10.1016/S0378-1119(02)00603-0
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our TRIM59 Antibody - BSA Free and receive a gift card or discount.