ME3 Antibody


Western Blot: ME3 Antibody [NBP1-85871] - Analysis in human cell line CAPAN-2.
Immunohistochemistry-Paraffin: ME3 Antibody [NBP1-85871] - Staining of human tonsil shows very weak granular cytoplasmic positivity in germinal center cells.
Immunohistochemistry-Paraffin: ME3 Antibody [NBP1-85871] - Staining of human endometrium shows moderate granular cytoplasmic positivity.
Immunohistochemistry-Paraffin: ME3 Antibody [NBP1-85871] - Staining of human kidney shows granular cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: ME3 Antibody [NBP1-85871] - Staining of human testis shows moderate to strong granular cytoplasmic positivity.
Orthogonal Strategies: Immunohistochemistry-Paraffin: ME3 Antibody [NBP1-85871] - Staining in human endometrium and tonsil tissues. Corresponding ME3 RNA-seq data are presented for the same tissues.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Validated by:

Orthogonal Strategies


Order Details

ME3 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: DVSLRIAIKVLDYAYKHNLASYYPEPKDKEAFVRSLVYTPDYDSFTLDSYTWPKEAMNVQTV
Specificity of human ME3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide

Reactivity Notes

Mouse (87%).

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for ME3 Antibody

  • EC 1.1.1
  • EC
  • FLJ34862
  • malate dehydrogenase
  • Malic enzyme 3
  • malic enzyme 3, NADP(+)-dependent, mitochondrial
  • malic enzyme, NADP+-dependent, mitochondrial
  • mitochondrial NADP(+)-dependent malic enzyme 3
  • NADP-dependent malic enzyme, mitochondrial
  • pyruvic-malic carboxylase


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IB, IHC, IHC-Fr, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb
Applications: WB
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq, GP, Rb
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Ch, Fe, Ha, Pl, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, IHC, IHC-P

Publications for ME3 Antibody (NBP1-85871) (0)

There are no publications for ME3 Antibody (NBP1-85871).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ME3 Antibody (NBP1-85871) (0)

There are no reviews for ME3 Antibody (NBP1-85871). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ME3 Antibody (NBP1-85871) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional ME3 Products

Bioinformatics Tool for ME3 Antibody (NBP1-85871)

Discover related pathways, diseases and genes to ME3 Antibody (NBP1-85871). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ME3 Antibody (NBP1-85871)

Discover more about diseases related to ME3 Antibody (NBP1-85871).

Pathways for ME3 Antibody (NBP1-85871)

View related products by pathway.

PTMs for ME3 Antibody (NBP1-85871)

Learn more about PTMs related to ME3 Antibody (NBP1-85871).

Blogs on ME3

There are no specific blogs for ME3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ME3 Antibody and receive a gift card or discount.


Gene Symbol ME3