Home » ME3 » ME3 Antibodies » ME3 Antibody

ME3 Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: ME3 Antibody [NBP1-85871] - Analysis in human cell line CAPAN-2.
Western Blot: ME3 Antibody [NBP1-85871] - Analysis in human cell line CAPAN-2.
Immunohistochemistry-Paraffin: ME3 Antibody [NBP1-85871] - Staining of human tonsil shows very weak granular cytoplasmic positivity in germinal center cells.
Immunohistochemistry-Paraffin: ME3 Antibody [NBP1-85871] - Staining of human endometrium shows moderate granular cytoplasmic positivity.
Immunohistochemistry-Paraffin: ME3 Antibody [NBP1-85871] - Staining of human kidney shows granular cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: ME3 Antibody [NBP1-85871] - Staining of human testis shows moderate to strong granular cytoplasmic positivity.
Orthogonal Strategies: Immunohistochemistry-Paraffin: ME3 Antibody [NBP1-85871] - Staining in human endometrium and tonsil tissues. Corresponding ME3 RNA-seq data are presented for the same tissues.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

  

Order Details

100% Guarantee on every product

ME3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: DVSLRIAIKVLDYAYKHNLASYYPEPKDKEAFVRSLVYTPDYDSFTLDSYTWPKEAMNVQTV
Specificity
Specificity of human ME3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ME3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ME3 Protein (NBP1-85871PEP)

Reactivity Notes

Mouse (87%).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ME3 Antibody

  • EC 1.1.1
  • EC 1.1.1.40
  • FLJ34862
  • malate dehydrogenase
  • Malic enzyme 3
  • malic enzyme 3, NADP(+)-dependent, mitochondrial
  • malic enzyme, NADP+-dependent, mitochondrial
  • mitochondrial NADP(+)-dependent malic enzyme 3
  • NADP-dependent malic enzyme, mitochondrial
  • NADP-ME
  • pyruvic-malic carboxylase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MDH2 Antibody
NBP1-32259
Western Blot: MDH2 Antibody [NBP1-32259] - Wild-type (WT) and MDH2 knockout (KO) 293T cell extracts (30 ug) were separated by 10% SDS-PAGE, and the membrane was blotted with MDH2 antibody diluted at 1:1000. HRP-conjugated anti-rabbit IgG antibody was used to detect the primary antibody.
Immunocytochemistry/Immunofluorescence: MDH2 Antibody [NBP1-32259] - HeLa cells were fixed in ice-cold MeOH for 5 min. Green: MDH2 protein stained by MDH2 antibody diluted at 1:500. Blue: Hoechst 33342 staining.
Immunohistochemistry-Paraffin: MDH2 Antibody [NBP1-32259] - MDH2 antibody detects MDH2 protein at mitochondria by immunohistochemical analysis. Sample: Paraffin-embedded rat colon. MDH2 stained by MDH2 antibody diluted at 1:500. Antigen Retrieval: Citrate buffer, pH 6.0, 15 min.
(1 Review)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Glucose 6
Phosphate Dehydrogena ...
NB100-236
Western Blot: Glucose 6 Phosphate Dehydrogenase Antibody [NB100-236] - Immunoblot analyses of protein expression for Nrf2 and antioxidant enzymes. Representative immunoblots of cytosolic extracts from the hearts of young and old mice under basal conditions and following EES. Protein blots were probed with anti-HO1, NQO1, GCLM, GCLC, Catalase, SOD1, SOD2, GSR, G6PD, GPX1 and GAPDH. Individual lanes indicate a single animal. Densitometry analysis of respective protein signals was performed using Image-J and expressed as relative intensity units calculated as mean values of young and old, *p<0.05. Individual lanes indicate each animal (n?=?6). #p<0.05-between basal and EES. Image collected and cropped by CiteAb from the following publication (http://dx.plos.org/10.1371/journal.pone.0045697), licensed under a CC-BY licence.
Western Blot: Glucose 6 Phosphate Dehydrogenase Antibody [NB100-236] - Detection of Human and Mouse G6PD by Western Blot. Samples: Whole cell lysate (50 ug) from HeLa, 293T, and mouse NIH3T3 cells prepared using NETN lysis buffer. Antibody: Affinity purified rabbit anti-G6PD antibody NB100-236 used for WB at 1 ug/ml. Detection: Chemiluminescence with an exposure time of 30 seconds.
Immunoprecipitation: Glucose 6 Phosphate Dehydrogenase Antibody [NB100-236] - Detection of mouse G6PD by western blot of immunoprecipitates. Samples: Whole cell lysate (0.5 or 1.0 mg per IP reaction; 20% of IP loaded) from NIH 3T3 cells prepared using NETN lysis buffer. Antibodies: Affinity purified rabbit anti-G6PD antibody NB100-236 (lot 2) used for IP at 6 ug per reaction. G6PD was also immunoprecipitated by a previous lot of this antibody (lot 1). For blotting immunoprecipitated G6PD, NB100-236 was used at 1 ug/ml. Detection: Chemiluminescence with an exposure time of 30 seconds.
(17 Publications)
Species: Hu, Mu
Applications: WB, IB, IHC, IHC-Fr, IP
PGD Antibody
(OTI2A5)
NBP2-45880
Western Blot: PGD Antibody (OTI2A5) [NBP2-45880] - Analysis of HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY PGD.
Immunohistochemistry-Paraffin: PGD Antibody (OTI2A5) [NBP2-45880] - Human thyroid tissue using anti-PGD mouse monoclonal antibody. (Heat-induced epitope retrieval by 10mM citric buffer, pH6.0, 100 degrees C for 10min.
Immunohistochemistry-Paraffin: PGD Antibody (OTI2A5) [NBP2-45880] - Human pancreas tissue within the normal limits using anti-PGD mouse monoclonal antibody. (Heat-induced epitope retrieval by 10mM citric buffer, pH6.0, 100 degrees C for 10min.
Species: Hu
Applications: WB, IHC, IHC-P, IF
Glucose 6
phosphate isomerase A ...
NBP2-02541
Western Blot: Glucose 6 phosphate isomerase Antibody (2D2) [NBP2-02541] Analysis of extracts (35ug) from 9 different cell lines by using anti-Glucose 6 phosphate isomerasemonoclonal antibody.
Immunocytochemistry/Immunofluorescence: Glucose 6 phosphate isomerase Antibody (2D2) [NBP2-02541] - Staining of COS7 cells transiently transfected by pCMV6-ENTRY Glucose 6 phosphate isomerase.
Immunohistochemistry-Paraffin: Glucose 6 phosphate isomerase Antibody (2D2) [NBP2-02541] - Staining of paraffin-embedded Human prostate tissue using anti-Glucose 6 phosphate isomerasemouse monoclonal antibody.
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
CS Citrate
Synthase Antibody (17
NBP2-43648
Western Blot: CS Citrate Synthase Antibody (1761) [NBP2-43648] - Non-transfected (Negative) and transfected (Positive) 293T whole cell extracts (30 ug) were separated by 10% SDS-PAGE, and the membrane was blotted with Citrate synthetase antibody diluted at 1:1000. The HRP-conjugated anti-mouse IgG antibody was used to detect the primary antibody.
Immunocytochemistry/Immunofluorescence: CS Citrate Synthase Antibody (1761) [NBP2-43648] - HeLa cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: Citrate synthetase protein stained by Citrate synthetase antibody [1761] diluted at 1:200. Red: phalloidin, a cytoskeleton marker, diluted at 1:50. Blue: Hoechst 33342 staining.
Immunohistochemistry-Paraffin: CS Citrate Synthase Antibody (1761) [NBP2-43648] - Analysis of mouse kidney. Citrate synthetase antibody [1761] dilution: 1:200.
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-P
Fumarase Antibody
NBP1-31336
Western Blot: Fumarase Antibody [NBP1-31336] - Various whole cell extracts (30 ug) were separated by 10% SDS-PAGE, and the membrane was blotted with Fumarate hydratase antibody diluted at 1:1000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Immunocytochemistry/Immunofluorescence: Fumarase Antibody [NBP1-31336] - HeLa cells were fixed in ice-cold MeOH for 5 min. Green: Fumarate hydratase protein stained by Fumarate hydratase antibody diluted at 1:500.Blue: Hoechst 33342 staining.
Immunohistochemistry-Paraffin: Fumarase Antibody [NBP1-31336] - Analysis of paraffin-embedded NCIN87 xenograft, using fumarate hydratase antibody at 1:500 dilution.
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MMP-12 Antibody
NBP1-31225
Western Blot: MMP-12 Antibody [NBP1-31225] - Sample(30 ug whole cell lysate) A:293T 10% SDS PAGE, antibody diluted at 1:1000.
Immunocytochemistry/Immunofluorescence: MMP-12 Antibody [NBP1-31225] - Analysis of methanol-fixed H1299, using antibody at 1:500 dilution.
Immunohistochemistry-Paraffin: MMP-12 Antibody [NBP1-31225] - Imaging of Human breast cancer tissue. MMP12 is stained by antibody (green) and nucleus is stained with DAPI (blue). This image was submitted via customer Review.
(2 Reviews)
(3 Publications)
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Catalase Antibody
NBP2-24916
Western Blot: Catalase Antibody [NBP2-24916] - Analysis in liver lysate of 1) human 2) mouse and 3) rat at 0.1 ug/ml.
Immunohistochemistry-Paraffin: Catalase Antibody [NBP2-24916] - Staining of human liver tissue using an isotype control (top) and this antibody (bottom) at 5 ug/ml.
(1 Review)
(6 Publications)
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
Insulin Antibody
(E2-E3 (same as INS04 ...
NBP2-34260
Immunohistochemistry-Paraffin: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260] - Insulin E2E3, human pancreas (FFPE), HIER pH 9 antigen retrieval. Image from verified customer review.
Immunohistochemistry-Paraffin: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260] - Formalin-fixed, paraffin-embedded human pancreas stained with insulin Monoclonal Antibody (E2-E3)
(5 Reviews)
(1 Publication)
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Dihydrolipoamide
Dehydrogenase/DLD Ant ...
NBP1-31302
Western Blot: Dihydrolipoamide Dehydrogenase/DLD Antibody [NBP1-31302] - Wild-type (WT) and DLD knockout (KO) HeLa cell extracts (30 ug) were separated by 10% SDS-PAGE, and the membrane was blotted with DLD antibody diluted at 1:500. HRP-conjugated anti-rabbit IgG antibody was used to detect the primary antibody.
Immunocytochemistry/Immunofluorescence: Dihydrolipoamide Dehydrogenase/DLD Antibody [NBP1-31302] - HeLa cells were fixed in ice-cold MeOH for 5 min. Green: DLD protein stained by DLD antibody diluted at 1:500. Blue: Hoechst 33342 staining.
Immunohistochemistry-Paraffin: Dihydrolipoamide Dehydrogenase/DLD Antibody [NBP1-31302] - Human gastric cancer, using DLD antibody at 1:100 dilution. Antigen Retrieval: Trilogy™ (EDTA based, pH 8.0) buffer, 15min.
(1 Review)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
PCK2 Antibody
(JB52-39)
NBP2-75610
Western Blot: PCK2 Antibody (JB52-39) [NBP2-75610] - Analysis of PCK2 on human kidney tissue (1) and MCF-7 cell (2) lysate using anti-PCK2 antibody at 1/500 dilution.
Immunocytochemistry/Immunofluorescence: PCK2 Antibody (JB52-39) [NBP2-75610] - Staining PCK2 in MCF-7 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: PCK2 Antibody (JB52-39) [NBP2-75610] - Analysis of paraffin-embedded rat kidney tissue using anti-PCK2 antibody. Counter stained with hematoxylin.
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
G6PC Antibody
NBP1-80533
Western Blot: G6PC Antibody [NBP1-80533] - Host: Rabbit. Target Name: G6PC. Sample Tissue: Mouse Testis. Antibody Dilution: 1ug/ml
Western Blot: G6PC Antibody [NBP1-80533] - Mouse Intestine, concentration 1 ug/ml.
Western Blot: G6PC Antibody [NBP1-80533] - Sample Tissue: Mouse Lung Antibody Dilution: 1.0ug/ml
(1 Review)
(4 Publications)
Species: Hu, Mu
Applications: WB
Glutaminyl-peptide
Cyclotransferase/QPCT ...
NBP1-81838
Western Blot: Glutaminyl-peptide Cyclotransferase/QPCT Antibody [NBP1-81838] - Analysis in control (vector only transfected HEK293T lysate) and QPCT over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: Glutaminyl-peptide Cyclotransferase/QPCT Antibody [NBP1-81838] - Staining in human adrenal gland and liver tissues using anti-QPCT antibody. Corresponding QPCT RNA-seq data are presented for the same tissues.
Western Blot: Glutaminyl-peptide Cyclotransferase/QPCT Antibody [NBP1-81838] - Analysis in human cell line SK-MEL-30.
(1 Publication)
Species: Hu, Mu
Applications: WB, IHC, IHC-P
PCK1 Antibody
NBP1-54825
Western Blot: PCK1 Antibody [NBP1-54825] - Human Fetal Muscle, Antibody Dilution: 1.0 ug/ml.
Immunohistochemistry-Paraffin: PCK1 Antibody [NBP1-54825] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.
Western Blot: PCK1 Antibody [NBP1-54825] - Human Fetal Brain Lysate, concentration 1.0ug/ml.
(1 Publication)
Species: Hu
Applications: WB, IHC, IHC-P
LAP3 Antibody
NBP1-82847
Western Blot: LAP3 Antibody [NBP1-82847] - Analysis using Anti-LAP3 antibody NBP1-82847 (A) shows similar pattern to independent antibody NBP1-82848 (B).
Immunocytochemistry/Immunofluorescence: LAP3 Antibody [NBP1-82847] - Staining of human cell line U-251 MG shows localization to nucleoplasm, cytosol & midbody.
Immunohistochemistry-Paraffin: LAP3 Antibody [NBP1-82847] - Staining of human kidney.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MDH1 Antibody
NBP1-89515
Western Blot: MDH1 Antibody [NBP1-89515] - Analysis in human cell line RT-4.
Immunocytochemistry/Immunofluorescence: MDH1 Antibody [NBP1-89515] - Staining of human cell line U-251 MG shows localization to cytosol & centrosome. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: MDH1 Antibody [NBP1-89515] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AKR1A1 Antibody
(OTI6E3)
NBP2-02164
Western Blot: AKR1A1 Antibody (6E3) [NBP2-02164] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY AKR1A1 (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-AKR1A1.
Immunocytochemistry/Immunofluorescence: AKR1A1 Antibody (6E3) [NBP2-02164] Staining of COS7 cells transiently transfected by pCMV6-ENTRY AKR1A1.
Immunohistochemistry-Paraffin: AKR1A1 Antibody (6E3) [NBP2-02164] - Staining of paraffin-embedded liver tissue using anti-AKR1A1 mouse monoclonal antibody.
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Fatty Acid
Synthase/FASN Antibod
NB400-114
Western Blot: Fatty Acid Synthase/FASN Antibody [NB400-114] - Expression of Fatty Acid Synthase in chicken hypothalamus. A: total RNA (1 ug) isolated from different tissues (brain, hypothalamus, liver and muscle) was subjected to RT-PCR using specific primers for chicken Fatty Acid Synthase (GenBank accession JO4485) or ribosomal 18S as a control (GenBank accession AF173612) B: tissue lysates (brain, hypothalmus, liver and muscle) were subjected to Western blot as described in MATERIALS AND METHODS. Blots were incubated with anti-Fatty Acid Synthase antibody and revealed by enhanced chemiluminescence. Picture compliments of Dridi S. et al, Am J Physiol Regul Integr Comp Physiol. 2006 Jul;291(1):R138-47. Epub 2006 Feb 2.
Immunocytochemistry/Immunofluorescence: Fatty Acid Synthase/FASN Antibody [NB400-114] - The Fas antibody was tested in MCF-7 cells at a 1:2000 dilution against Dylight 488 (Green). Alpha tubulin and nuclei were counterstained against Dylight 550 (Red) and DAPI (Blue), respectively.
Immunohistochemistry-Paraffin: Fatty Acid Synthase/FASN Antibody [NB400-114] - Immunohistochemical localization of FAS in chicken hypothalmus. Paraffin sections were obtained from 3-wk-old broiler chickens.
(2 Reviews)
(23 Publications)
Species: Hu, Mu, Rt, Po, Ch, Fe, Ha, Pl, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP, KD
Mouse Complement
C4 ELISA Kit (Colorim ...
NBP2-70040
Mouse Complement C4 ELISA Kit (Colorimetric) - Standard Curve Reference
Species: Mu
ME3 Antibody
NBP1-85871
ME3 Antibody
Species: Hu
Applications: WB, IHC, IHC-P

Publications for ME3 Antibody (NBP1-85871) (0)

There are no publications for ME3 Antibody (NBP1-85871).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ME3 Antibody (NBP1-85871) (0)

There are no reviews for ME3 Antibody (NBP1-85871). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ME3 Antibody (NBP1-85871) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional ME3 Products

Bioinformatics Tool for ME3 Antibody (NBP1-85871)

Discover related pathways, diseases and genes to ME3 Antibody (NBP1-85871). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ME3 Antibody (NBP1-85871)

Discover more about diseases related to ME3 Antibody (NBP1-85871).
 

Pathways for ME3 Antibody (NBP1-85871)

View related products by pathway.

PTMs for ME3 Antibody (NBP1-85871)

Learn more about PTMs related to ME3 Antibody (NBP1-85871).

Blogs on ME3

There are no specific blogs for ME3, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ME3 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol ME3