ME3 Antibody

Images

 
Western Blot: ME3 Antibody [NBP1-85871] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunohistochemistry-Paraffin: ME3 Antibody [NBP1-85871] - Staining of human parathyroid gland shows moderate cytoplasmic positivity in glandular cells.
Western Blot: ME3 Antibody [NBP1-85871] - Analysis in human cell line CAPAN-2.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ME3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:DVSLRIAIKVLDYAYKHNLASYYPEPKDKEAFVRSLVYTPDYDSFTLDSYTWPKEAMNVQTV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ME3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500-1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ME3 Protein (NBP1-85871PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ME3 Antibody

  • EC 1.1.1
  • EC 1.1.1.40
  • FLJ34862
  • malate dehydrogenase
  • Malic enzyme 3
  • malic enzyme 3, NADP(+)-dependent, mitochondrial
  • malic enzyme, NADP+-dependent, mitochondrial
  • mitochondrial NADP(+)-dependent malic enzyme 3
  • NADP-dependent malic enzyme, mitochondrial
  • NADP-ME
  • pyruvic-malic carboxylase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32259
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-236
Species: Hu, Mu
Applications: WB, IB, IHC, IHC-Fr, IHC-P, IP
NBP1-31589
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02541
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-43648
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31336
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31241
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80533
Species: Mu
Applications: WB
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-54825
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-82847
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89515
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02164
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB400-114
Species: Hu, Mu, Rt, Po, Ch, Ha, Pl, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-34234
Species: Hu
Applications: ICC/IF, IHC-Fr, IHC-P

Publications for ME3 Antibody (NBP1-85871) (0)

There are no publications for ME3 Antibody (NBP1-85871).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ME3 Antibody (NBP1-85871) (0)

There are no reviews for ME3 Antibody (NBP1-85871). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ME3 Antibody (NBP1-85871) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ME3 Products

Bioinformatics Tool for ME3 Antibody (NBP1-85871)

Discover related pathways, diseases and genes to ME3 Antibody (NBP1-85871). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ME3 Antibody (NBP1-85871)

Discover more about diseases related to ME3 Antibody (NBP1-85871).
 

Pathways for ME3 Antibody (NBP1-85871)

View related products by pathway.

PTMs for ME3 Antibody (NBP1-85871)

Learn more about PTMs related to ME3 Antibody (NBP1-85871).

Blogs on ME3

There are no specific blogs for ME3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ME3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ME3