ME3 Antibody

Western Blot: ME3 Antibody [NBP1-54755] - 721_B cell lysate, concentration 0.2-1 ug/ml.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

ME3 Antibody Summary

• Immunogen: Synthetic peptides corresponding to ME3(malic enzyme 3, NADP(+)-dependent, mitochondrial) The peptide sequence was selected from the N terminal of ME3. Peptide sequence PGPARPVPLKKRGYDVTRNPHLNKGMAFTLEERLQLGIHGLIPPCFLSQD.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ME3
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:100-1:2000
• Application Notes: This is a rabbit polyclonal antibody against ME3 and was validated on Western blot.
• Theoretical MW: 67 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Purity: Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ME3 Antibody

• EC 1.1.1
• EC 1.1.1.40
• FLJ34862
• malate dehydrogenase
• Malic enzyme 3
• malic enzyme 3, NADP(+)-dependent, mitochondrial
• malic enzyme, NADP+-dependent, mitochondrial
• mitochondrial NADP(+)-dependent malic enzyme 3
• NADP-dependent malic enzyme, mitochondrial
• NADP-ME
• pyruvic-malic carboxylase

Background

Malic enzyme catalyzes the oxidative decarboxylation of malate to pyruvate using either NAD+ or NADP+ as a cofactor. Mammalian tissues contain 3 distinct isoforms of malic enzyme: a cytosolic NADP(+)-dependent isoform, a mitochondrial NADP(+)-dependent isoform, and a mitochondrial NAD(+)-dependent isoform. ME3 is a mitochondrial NADP(+)-dependent isoform. Malic enzyme catalyzes the oxidative decarboxylation of malate to pyruvate using either NAD+ or NADP+ as a cofactor. Mammalian tissues contain 3 distinct isoforms of malic enzyme: a cytosolic NADP(+)-dependent isoform, a mitochondrial NADP(+)-dependent isoform, and a mitochondrial NAD(+)-dependent isoform. This gene encodes a mitochondrial NADP(+)-dependent isoform. Multiple alternatively spliced transcript variants have been found for this gene, but the biological validity of some variants has not been determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ME3
• Uniprot:
  • Q16798(Human)