MDMX Antibody

Images

 
Western Blot: MDMX Antibody [NBP2-58791] - Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
Immunocytochemistry/ Immunofluorescence: MDMX Antibody [NBP2-58791] - Staining of human cell line U-251 MG shows localization to nucleoplasm.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MDMX Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LSDDTDVEVTSEDEWQCTECKKFNSPSKRYCFRCWALRKDWYSDCSKLTHSLSTSDITAIPEKENEGNDVPDCRRTISAPVVRPKDAYIKKENS
Predicted Species
Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MDM4
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Western Blot 0.04-0.4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MDMX Recombinant Protein Antigen (NBP2-58791PEP)

Reactivity Notes

Mouse 89%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for MDMX Antibody

  • DKFZp781B1423
  • double minute 4 homolog
  • Double minute 4 protein
  • double minute 4, human homolog of; p53-binding protein
  • HDMX
  • Mdm2-like p53-binding protein
  • Mdm4 p53 binding protein homolog (mouse)
  • MDM4 Regulator of P53
  • MDM4
  • Mdm4, transformed 3T3 cell double minute 4, p53 binding protein (mouse)
  • Mdm4, transformed 3T3 cell double minute 4, p53 binding protein
  • MDM4-related protein 1
  • MDMX
  • MDMXMGC132766
  • mouse double minute 4, human homolog of; p53-binding protein
  • MRP1
  • p53-binding protein Mdm4
  • protein Mdm4
  • Protein Mdmx

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB400-156
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Dual ISH-IHC, ELISA, Flow, ICC/IF, IHC, IP, WB
NBP2-67667
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP2-66958
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-22124
Species: Hu, Mu, Pm
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP1-76670
Species: Hu, Rt
Applications: ELISA, IHC, IHC-P, WB
NBP2-13415
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-2736
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, IP, WB
NBP2-38160
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-85009
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-37923
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-33560
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KO, WB
NBP2-58327
Species: Hu, Mu
Applications: ICC/IF, WB
NBP2-46467
Species: Hu, Mu, Rt
Applications: IHC, WB
NB100-1471
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA, WB
AF6278
Species: Hu, Mu
Applications: WB
NB100-64808
Species: Hu, Mu
Applications: ELISA, Flow, IF, IHC, IHC-Fr, IP, WB
NBP1-89683
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-79854
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, PA, WB
NBP2-58791
Species: Hu, Rt
Applications: WB, ICC/IF

Publications for MDMX Antibody (NBP2-58791) (0)

There are no publications for MDMX Antibody (NBP2-58791).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MDMX Antibody (NBP2-58791) (0)

There are no reviews for MDMX Antibody (NBP2-58791). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MDMX Antibody (NBP2-58791) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MDMX Products

Bioinformatics Tool for MDMX Antibody (NBP2-58791)

Discover related pathways, diseases and genes to MDMX Antibody (NBP2-58791). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MDMX Antibody (NBP2-58791)

Discover more about diseases related to MDMX Antibody (NBP2-58791).
 

Pathways for MDMX Antibody (NBP2-58791)

View related products by pathway.

PTMs for MDMX Antibody (NBP2-58791)

Learn more about PTMs related to MDMX Antibody (NBP2-58791).
 

Research Areas for MDMX Antibody (NBP2-58791)

Find related products by research area.

Blogs on MDMX

There are no specific blogs for MDMX, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MDMX Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MDM4