MDH1 Antibody (1D2)

Images

 
Western Blot: MDH1 Antibody (1D2) [H00004190-M03] - Analysis of MDH1 expression in transfected 293T cell line by MDH1 monoclonal antibody (M03), clone 1D2. Lane 1: MDH1 transfected lysatE (36.4 KDa). Lane 2: ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
1D2
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

MDH1 Antibody (1D2) Summary

Immunogen
MDH1 (AAH01484.1, 101 a.a. - 193 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LLKANVKIFKSQGAALDKYAKKSVKVIVVGNPANTNCLTASKSAPSIPKENFSCLTRLDHNRAKAQIALKLGVTANDVKNVIIWGNHSSTQYP
Specificity
MDH1 - malate dehydrogenase 1, NAD (soluble) (1D2)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
MDH1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MDH1 Antibody (1D2)

  • cytoplasmic
  • Cytosolic malate dehydrogenase
  • malate dehydrogenase 1, NAD (soluble)
  • MDHA
  • MDH-s
  • MGC:1375
  • MOR2
  • soluble malate dehydrogenase

Background

Malate dehydrogenase catalyzes the reversible oxidation of malate to oxaloacetate, utilizing the NAD/NADH cofactor system in the citric acid cycle. The protein encoded by this gene is localized to the cytoplasm and may play pivotal roles in the malate-aspartate shuttle that operates in the metabolic coordination between cytosol and mitochondria. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32398
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-54755
Species: Hu
Applications: WB
NBP2-34980
Species: Hu
NBP1-32259
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-02541
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31589
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-236
Species: Hu, Mu
Applications: WB, IB, IHC, IHC-Fr, IHC-P, IP
NBP1-47804
Species: Hu, Mk
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NBP1-87404
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00005236-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP, RNAi
NBP2-43648
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84956
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-48336
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-24557
Species: Hu, Eq, Pm
Applications: WB, IHC-P
NBP2-45897
Species: Hu
Applications: WB, IHC
NBP2-53421
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for MDH1 Antibody (H00004190-M03) (0)

There are no publications for MDH1 Antibody (H00004190-M03).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MDH1 Antibody (H00004190-M03) (0)

There are no reviews for MDH1 Antibody (H00004190-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MDH1 Antibody (H00004190-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MDH1 Products

Bioinformatics Tool for MDH1 Antibody (H00004190-M03)

Discover related pathways, diseases and genes to MDH1 Antibody (H00004190-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MDH1 Antibody (H00004190-M03)

Discover more about diseases related to MDH1 Antibody (H00004190-M03).
 

Pathways for MDH1 Antibody (H00004190-M03)

View related products by pathway.

PTMs for MDH1 Antibody (H00004190-M03)

Learn more about PTMs related to MDH1 Antibody (H00004190-M03).
 

Research Areas for MDH1 Antibody (H00004190-M03)

Find related products by research area.

Blogs on MDH1

There are no specific blogs for MDH1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MDH1 Antibody (1D2) and receive a gift card or discount.

Bioinformatics

Gene Symbol MDH1
Entrez
Uniprot