MDA5 Antibody

Images

 
Western Blot: MDA5 Antibody [NBP1-89685] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: SK-MEL-30
Immunocytochemistry/ Immunofluorescence: MDA5 Antibody [NBP1-89685] - Staining of human cell line U-2 OS shows positivity in cytoplasm.
Immunohistochemistry-Paraffin: MDA5 Antibody [NBP1-89685] - Staining of human thyroid gland shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MDA5 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:TIRMIDAYTHLETFYNEEKDKKFAVIEDDSDEGGDDEYCDGDEDEDDLKKPLKLDETDRFLMTLFFENNKMLKRLAENPEYENEKLTKLRNTIMEQYTRTEESARGIIFTKTRQSAYALSQWITENEKFAEVGVKAHHLIGAGHSSEFKP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
IFIH1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MDA5 Protein (NBP1-89685PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MDA5 Antibody

  • CADM-140 autoantigen
  • Clinically amyopathic dermatomyositis autoantigen 140 kDa
  • DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide
  • EC 3.6.4.13
  • helicard
  • Helicase with 2 CARD domains
  • Hlcd
  • IDDM19
  • interferon induced with helicase C domain 1
  • interferon-induced helicase C domain-containing protein 1
  • Interferon-induced with helicase C domain protein 1
  • MDA-5MGC133047
  • MDA5RNA helicase-DEAD box protein 116
  • melanoma differentiation associated protein-5
  • Melanoma differentiation-associated protein 5
  • Murabutide down-regulated protein
  • RH116

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-27109
Species: Hu, Mu, Po, Pm
Applications: WB, Simple Western, IHC, IHC-P
NBP2-24875
Species: Hu, Mu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP2-22380
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85348
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-47812
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-47415
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB120-13810
Species: Hu, Mu, Rt, Po
Applications: WB, Simple Western, IB, ICC/IF, IP
NBP2-24906
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Flow-IC, IF
NBP1-77266
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
AF8519
Species: Hu, Mu, Rt
Applications: WB
NB100-56705
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
AF6139
Species: Hu
Applications: ICC
NBP1-89685
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for MDA5 Antibody (NBP1-89685) (0)

There are no publications for MDA5 Antibody (NBP1-89685).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MDA5 Antibody (NBP1-89685) (0)

There are no reviews for MDA5 Antibody (NBP1-89685). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MDA5 Antibody (NBP1-89685) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MDA5 Products

Bioinformatics Tool for MDA5 Antibody (NBP1-89685)

Discover related pathways, diseases and genes to MDA5 Antibody (NBP1-89685). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MDA5 Antibody (NBP1-89685)

Discover more about diseases related to MDA5 Antibody (NBP1-89685).
 

Pathways for MDA5 Antibody (NBP1-89685)

View related products by pathway.

PTMs for MDA5 Antibody (NBP1-89685)

Learn more about PTMs related to MDA5 Antibody (NBP1-89685).
 

Research Areas for MDA5 Antibody (NBP1-89685)

Find related products by research area.

Blogs on MDA5.

MDA5 - Part of the RIG-I-like Receptor Family
The innate immune system is responsible for reacting to viral infections through recognition of various viral components. Like toll-like receptor 3 (TLR3), MDA5 recognizes double-stranded (ds) RNA which is a molecular pattern indicative of viral infec...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MDA5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol IFIH1