MCT1/SLC16A1 Antibody

Images

 
Western Blot: MCT1/SLC16A1 Antibody [NBP1-89574] - Analysis in human cell line NTERA-2.
Immunocytochemistry/ Immunofluorescence: MCT1/SLC16A1 Antibody [NBP1-89574] - Immunofluorescent staining of human cell line U-251 MG shows localization to plasma membrane.
Immunohistochemistry-Paraffin: MCT1/SLC16A1 Antibody [NBP1-89574] - Staining of human colon shows strong cytoplasmic and membranous positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MCT1/SLC16A1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PTKAGKDKSKASLEKAGKSGVKKDLHDANTDLIGRHPKQEKRSVFQTINQFLDLTLFTHRGF
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC16A1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:500-1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MCT1/SLC16A1 Protein (NBP1-89574PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MCT1/SLC16A1 Antibody

  • FLJ36745
  • HHF7
  • MCT 1
  • MCT
  • MCT1MGC44475
  • member 1
  • monocarboxylate transporter 1
  • Solute carrier family 16 member 1
  • solute carrier family 16, member 1 (monocarboxylic acid transporter 1)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-13315
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-81251
Species: Hu
Applications: Simple Western, ICC/IF, IHC, IHC-P
NBP2-50509
Species: Hu
Applications: IHC, IP
NBP1-87846
Species: Hu
Applications: WB, IHC, IHC-P
AF972
Species: Hu
Applications: WB, Simple Western, IHC
NB110-39113
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-52084
Species: Hu, Mu, Rt
Applications: WB, IHC-P, PEP-ELISA
NBP1-05164
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
NBP1-59885
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-57308
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-43648
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
NB300-500
Species: Hu, Mu, Rt, Po, Am, Bv, Ca, Dr
Applications: WB, IHC, IHC-Fr, IHC-P
NB100-65214
Species: Hu, Mu, Rt, Ma
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
AF7197
Species: Hu, Mu
Applications: WB, IHC, ICC

Publications for MCT1/SLC16A1 Antibody (NBP1-89574) (0)

There are no publications for MCT1/SLC16A1 Antibody (NBP1-89574).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MCT1/SLC16A1 Antibody (NBP1-89574) (0)

There are no reviews for MCT1/SLC16A1 Antibody (NBP1-89574). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MCT1/SLC16A1 Antibody (NBP1-89574) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MCT1/SLC16A1 Products

Bioinformatics Tool for MCT1/SLC16A1 Antibody (NBP1-89574)

Discover related pathways, diseases and genes to MCT1/SLC16A1 Antibody (NBP1-89574). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MCT1/SLC16A1 Antibody (NBP1-89574)

Discover more about diseases related to MCT1/SLC16A1 Antibody (NBP1-89574).
 

Pathways for MCT1/SLC16A1 Antibody (NBP1-89574)

View related products by pathway.

PTMs for MCT1/SLC16A1 Antibody (NBP1-89574)

Learn more about PTMs related to MCT1/SLC16A1 Antibody (NBP1-89574).
 

Research Areas for MCT1/SLC16A1 Antibody (NBP1-89574)

Find related products by research area.

Blogs on MCT1/SLC16A1.

Monocarboxylate Transporter 1 (MCT1) - a novel oncogene
MCT1 is a proton-linked transport carrier that catalyzes the movement of short chain monocarboxylates (branched-chain oxo acids derived from leucine, valine, and isoleucine) across both plasma and inner mitochondrial membranes. In particular, subst...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MCT1/SLC16A1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC16A1