MCPH1 Antibody

Images

 
Western Blot: MCPH1 Antibody [NBP1-89937] - Analysis in human cell line NTERA-2.
Immunohistochemistry-Paraffin: MCPH1 Antibody [NBP1-89937] - Staining of human testis shows moderate to strong nuclear positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: MCPH1 Antibody [NBP1-89937] - Staining of human cerebellum shows moderate nuclear positivity in Purkinje and granular cell layers.
Immunohistochemistry-Paraffin: MCPH1 Antibody [NBP1-89937] - Staining of human cerebral cortex shows moderate to strong nuclear positivity in neurons.
Immunohistochemistry-Paraffin: MCPH1 Antibody [NBP1-89937] - Staining of human liver shows no nuclear positivity in hepatocytes as expected.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MCPH1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: AVGLKSTQNKGTTSKISNSSEGEAQSEHEPCFIVDCNMETSTEEKENLPGGYSGSVKNRPTRHDVLDDSCDGFKDLIKPHEELKKSGRGKKPTRTLVMTSMPSEKQNVVIQVVDKLKGFSIAPDVCETTTHVLSGKPLRTLNVLLGI
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MCPH1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
MCPH1 Protein (NBP1-89937PEP)
Publications
Read Publication using NBP1-89937.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23472065)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MCPH1 Antibody

  • BRCT-repeat inhibitor of TERT expression 1
  • BRIT1
  • FLJ12847
  • MCPH1
  • MCT
  • microcephalin 1
  • Microcephalin
  • microcephaly, primary autosomal recessive 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-12238
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IP, WB
NBP1-59656
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP2-03626
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-13315
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-81251
Species: Hu, Mu
Applications: IB, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
NB300-877
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
NB100-64848
Species: Rt
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP2-48615
Species: Hu
Applications: IHC, IHC-P, WB
NB100-2278
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NB120-14817
Species: Hu, Rt
Applications: ICC/IF, IHC, S-ELISA, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
D6050
Species: Hu
Applications: ELISA
NB100-464
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
NBP2-34294
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P
NB300-500
Species: Am, Bv, Ca, Dr, Hu, Mu, Po, Rt, Sh
Applications: IHC, IHC-Fr, IHC-P, WB
AF009
Species: Hu
Applications: IHC, WB
NBP1-89937
Species: Hu
Applications: WB, IHC, IHC-P

Publications for MCPH1 Antibody (NBP1-89937)(1)

Reviews for MCPH1 Antibody (NBP1-89937) (0)

There are no reviews for MCPH1 Antibody (NBP1-89937). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MCPH1 Antibody (NBP1-89937) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MCPH1 Products

Bioinformatics Tool for MCPH1 Antibody (NBP1-89937)

Discover related pathways, diseases and genes to MCPH1 Antibody (NBP1-89937). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MCPH1 Antibody (NBP1-89937)

Discover more about diseases related to MCPH1 Antibody (NBP1-89937).
 

Pathways for MCPH1 Antibody (NBP1-89937)

View related products by pathway.

PTMs for MCPH1 Antibody (NBP1-89937)

Learn more about PTMs related to MCPH1 Antibody (NBP1-89937).
 

Research Areas for MCPH1 Antibody (NBP1-89937)

Find related products by research area.

Blogs on MCPH1

There are no specific blogs for MCPH1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MCPH1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MCPH1