MCM7 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: MCM7 Antibody [NBP1-85721] - Immunofluorescent staining of human cell line MCF7 shows localization to nucleoplasm. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: MCM7 Antibody [NBP1-85721] - Staining in human appendix and pancreas tissues using anti-MCM7 antibody. Corresponding MCM7 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: MCM7 Antibody [NBP1-85721] - Staining of human appendix shows high expression.

Immunohistochemistry-Paraffin: MCM7 Antibody [NBP1-85721] - Staining of human pancreas shows low expression as expected.

Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Analysis in human cell line MCF-7.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

MCM7 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit MCM7 Antibody - BSA Free (NBP1-85721) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: QSPTFMPLIMCPSQECQTNRSGGRLYLQTRGSRFIKFQEMKMQEHSDQVPVGNIPRSITVLVEGENTRIAQPGDHVSVTGIFLPILRTGFRQVVQGLLSETYLEAHRIVKMNKSEDDESGAGE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MCM7
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  MCM7 Protein (NBP1-85721PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for MCM7 Antibody - BSA Free

• CDC47 homolog
• CDC47
• CDC47P85MCM
• DNA replication licensing factor MCM7
• EC 3.6.4.12
• homolog of S. cerevisiae Cdc47
• MCM2
• MCM2PNAS146
• MCM7 minichromosome maintenance deficient 7 (S. cerevisiae)
• MCM7
• minichromosome maintenance complex component 7
• minichromosome maintenance deficient (S. cerevisiae) 7
• minichromosome maintenance deficient 7
• P1.1-MCM3
• P1CDC47
• P85MCM
• PNAS146
• PPP1R104
• Protein Phosphatase 1

Background

The minichromosome maintenance (MCM7) helicase complex functions to initiate and elongate replication forks. Cell cycle checkpoint signaling pathways regulate DNA replication to maintain genomic stability (1). MCM7 is a putative human homologue of yeast CDC47 and a member of the MCM protein family, which has been implicated in the regulatory machinery causing DNA to replicate only once in the S phase. Findings indicate that MCM7 protein together with other MCM proteins participates in the regulation of mammalian DNA replication (2). In HeLa cells, depletion of MCM7 with small-interfering RNA suppressed ultraviolet (UV) light- or aphidicolin-induced hChk1 phosphorylation, and abolished UV-induced S-phase checkpoint activation. These results demonstrate that MCM7 plays a direct role in the transmission of DNA damage signals from active replication forks to the S-phase checkpoint machinery in human cells (3).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MCM7