MCM5 Antibody

Images

 
Western Blot: MCM5 Antibody [NBP1-85722] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunohistochemistry-Paraffin: MCM5 Antibody [NBP1-85722] - Staining of human testis shows strong nuclear positivity in cells in seminiferus ducts.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MCM5 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:NRYIIMRSGARQHERDSDRRSSIPITVRQLEAIVRIAEALSKMKLQPFATEADVEEALRLFQVSTLDAALSGTLSGVEGFTSQEDQEMLSRIEKQLKRRFAIGSQVSEHSIIKDFTKQKYPEHAIHKVLQLMLRRGEIQHRMQRKVLY
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MCM5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
MCM5 Protein (NBP1-85722PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MCM5 Antibody

  • CDC46 homolog
  • CDC46DNA replication licensing factor MCM5
  • EC 3.6.4.12
  • MCM5 minichromosome maintenance deficient 5, cell division cycle 46 (S.cerevisiae)
  • MCM5 minichromosome maintenance deficient 5, cell division cycle 46
  • MGC5315
  • minichromosome maintenance complex component 5
  • minichromosome maintenance deficient (S. cerevisiae) 5 (cell division cycle 46)
  • minichromosome maintenance deficient 5 (cell division cycle 46)
  • P1-CDC46

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB92171
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC
NBP1-87423
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-46403
Species: Hu
Applications: IHC
NB100-288
Species: Hu, Xp
Applications: WB, IHC, IHC-P, IP, PLA
NB100-290
Species: Hu, Mu, Xp
Applications: IP (-), WB, IHC, PLA
NB100-249
Species: Hu
Applications: WB, IHC, PLA, ICC
NBP1-82642
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB200-581
Species: Hu, Rt
Applications: WB, IP
NBP1-85723
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB120-10535
Species: Hu
Applications: WB, ELISA, ICC/IF, IP, MiAr
NBP1-59448
Species: Hu
Applications: WB
NBP2-30949
Species: Hu
Applications: IHC, IHC-P
NBP1-97512
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81293
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-57614
Species: Hu
Applications: ICC/IF
NBP2-49365
Species: Hu
Applications: ICC/IF, IHC
NBP1-85722
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for MCM5 Antibody (NBP1-85722) (0)

There are no publications for MCM5 Antibody (NBP1-85722).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MCM5 Antibody (NBP1-85722) (0)

There are no reviews for MCM5 Antibody (NBP1-85722). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MCM5 Antibody (NBP1-85722) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MCM5 Products

Bioinformatics Tool for MCM5 Antibody (NBP1-85722)

Discover related pathways, diseases and genes to MCM5 Antibody (NBP1-85722). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MCM5 Antibody (NBP1-85722)

Discover more about diseases related to MCM5 Antibody (NBP1-85722).
 

Pathways for MCM5 Antibody (NBP1-85722)

View related products by pathway.

PTMs for MCM5 Antibody (NBP1-85722)

Learn more about PTMs related to MCM5 Antibody (NBP1-85722).
 

Research Areas for MCM5 Antibody (NBP1-85722)

Find related products by research area.

Blogs on MCM5

There are no specific blogs for MCM5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MCM5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MCM5