MBTPS1 Antibody

Images

 
Immunohistochemistry: MBTPS1 Antibody [NBP2-49214] - Staining of human heart muscle shows strong cytoplasmic positivity in myocytes.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MBTPS1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: YPPGYFPRDNLRMKNDPLDWNGDHIHTNFRDMYQHLRSMGYFVEVLGAPFTCFDASQYGTLLMVDSEEEYFPEEIAKLRRDVDNGLSLVIFSDWYNTSVMRKVKFYDENTRQWWMPDTGGANIPALNELLSV
Predicted Species
Mouse (98%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MBTPS1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
MBTPS1 Recombinant Protein Antigen (NBP2-49214PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MBTPS1 Antibody

  • EC 3.4.21.112
  • Endopeptidase S1P
  • KIAA0091MGC138712
  • membrane-bound transcription factor peptidase, site 1
  • membrane-bound transcription factor protease, site 1
  • PCSK8
  • S1PMGC138711
  • site-1 protease
  • SKI1
  • SKI-1membrane-bound transcription factor site-1 protease
  • subtilisin/kexin isozyme-1
  • Subtilisin/kexin-isozyme 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB7089
Species: Mu
Applications: CyTOF-ready, Flow, IHC
H00008877-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP2-37477
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP2-24762
Species: Hu, Mu
Applications: IHC, IHC-P, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NBP2-26691
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP2-67360
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP2-52567
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
AF467
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
NBP2-25160
Species: Bv, Ca, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, WB
NBP1-58359
Species: Hu
Applications: IHC, IHC-P, WB
DVE00
Species: Hu
Applications: ELISA
NBP3-04811
Species: Hu, Mu
Applications: WB
NBP2-97681
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NLS1017
Species: Bt, Bv, Ca, Eq, Hu, Mu
Applications: IHC, IHC-P
NBP1-40256
Species: Hu, Mu, Pl, Po, Rb, Rt
Applications: ChIP, CyTOF-ready, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KO, WB
D6050
Species: Hu
Applications: ELISA
MAB194
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, WB

Publications for MBTPS1 Antibody (NBP2-49214) (0)

There are no publications for MBTPS1 Antibody (NBP2-49214).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MBTPS1 Antibody (NBP2-49214) (0)

There are no reviews for MBTPS1 Antibody (NBP2-49214). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for MBTPS1 Antibody (NBP2-49214) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MBTPS1 Products

Bioinformatics Tool for MBTPS1 Antibody (NBP2-49214)

Discover related pathways, diseases and genes to MBTPS1 Antibody (NBP2-49214). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MBTPS1 Antibody (NBP2-49214)

Discover more about diseases related to MBTPS1 Antibody (NBP2-49214).
 

Pathways for MBTPS1 Antibody (NBP2-49214)

View related products by pathway.

PTMs for MBTPS1 Antibody (NBP2-49214)

Learn more about PTMs related to MBTPS1 Antibody (NBP2-49214).

Blogs on MBTPS1

There are no specific blogs for MBTPS1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MBTPS1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MBTPS1