Western Blot: MBP Antibody (7D2) [NBP1-05204] - Analysis of different tissue lysates using mouse mAb to MBP, NBP1-05204, dilution 1:10,000 in green: [1] protein standard (red), [2] rat brain, [3] rat spinal cord, [4] ...read more
Immunohistochemistry: MBP Antibody (7D2) [NBP1-05204] - Analysis rat brain hippocampal section stained with mouse mAb to myelin basic protein (MBP), NBP1-05204, dilution 1:5,000 in green, and costained with rabbit pAb ...read more
Purified myelin basic protein isolated from bovine brain, epitope maps to the peptide AEGQRPGFGYGGRASDYKSAHKGFKGVDAQGTLSKIFKLG, amino acids 145-184 of the human 21.5kDa sequence.
Marker
Oligodendrocyte Marker, Myelin Marker
Specificity
The MBP Antibody (7D2) antibody binds only the 21.5kDa and 18.5kDa rat MBP isotypes, but all four isotypes of human and bovine MBP.
Isotype
IgG1
Clonality
Monoclonal
Host
Mouse
Gene
MBP
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
This Myelin Basic Protein (7D2) antibody is useful for Immunocytochemistry/Immunofluorescence and Western blot, where a band can be seen at ~21.5 kDa.
Theoretical MW
18.5/21.5 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publications using NBP1-05204 in the following applications:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
50% PBS, 50% glycerol
Preservative
5mM Sodium Azide
Concentration
1 mg/ml
Purity
Affinity purified
Alternate Names for MBP Antibody (7D2) - BSA Free
Hmbpr
MBP
MGC99675
mld
Myelin A1 protein
myelin basic protein
Myelin membrane encephalitogenic protein
shi
Background
Myelin Basic protein (MBP), along with myelin proteolipid protein (PLP/lipophilin), is the most abundant protein constituents of myelin membrane in the CNS cells. MBP plays a key role in both the formation as well as the stabilization of this compact multilayer arrangement of bilayers. MBP is a homodimer that can self-associates in the presence of lysolipid, and is localized in myelin membrane as peripheral membrane protein on the cytoplasmic side of myelin. MBP is found in CNS/PNS and after post-translational modifications (PTMs), at least 6 charge isomers are produced: C1 (most cationic/least modified form), C2, C3, C4, C5 and C6 (the least cationic form); and its potential PTMs includes - phosphorylation of serine or threonine residues, deamidation of glutamine or asparagine residues, citrullination and methylation of arginine residues. MBP phosphorylations are executed by TAOK2, VRK2, MAPK11, MAPK12, MAPK14 and MINK1. Citrullination and methylation modifications of MBP may lead to reduction in surface charge that follows its weakened attachment with myelin membranes and this mechanism has been proposed to be operative in demyelinating diseases such as chronical multiple sclerosis (MS), fulminating MS (Marburg disease) etc.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our MBP Antibody (7D2) - BSA Free and receive a gift card or discount.