MBP Antibody (7D2)


Western Blot: MBP Antibody (7D2) [NBP1-05204] - Analysis of different tissue lysates using mouse mAb to MBP, NBP1-05204, dilution 1:10,000 in green: [1] protein standard (red), [2] rat brain, [3] rat spinal cord, [4] ...read more
Immunohistochemistry: MBP Antibody (7D2) [NBP1-05204] - Analysis rat brain hippocampal section stained with mouse mAb to myelin basic protein (MBP), NBP1-05204, dilution 1:5,000 in green, and costained with rabbit pAb ...read more

Product Details

Reactivity Hu, Mu, Rt, Po, Bv, EqSpecies Glossary
Applications WB, ICC/IF, IHC
1 mg/ml

Order Details

MBP Antibody (7D2) Summary

Purified myelin basic protein isolated from bovine brain, epitope maps to the peptide AEGQRPGFGYGGRASDYKSAHKGFKGVDAQGTLSKIFKLG, amino acids 145-184 of the human 21.5kDa sequence.
Oligodendrocyte Marker, Myelin Marker
The MBP Antibody (7D2) antibody binds only the 21.5kDa and 18.5kDa rat MBP isotypes, but all four isotypes of human and bovine MBP.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/ Immunofluorescence 1:1000
  • Immunohistochemistry 1:1000
  • Western Blot 1:5000-1:10000
Application Notes
This Myelin Basic Protein (7D2) antibody is useful for Immunocytochemistry/Immunofluorescence and Western blot, where a band can be seen at ~21.5 kDa.
Theoretical MW
18.5/21.5 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Read Publications using
NBP1-05204 in the following applications:

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
50% PBS, 50% glycerol
5mM Sodium Azide
1 mg/ml
Affinity purified

Alternate Names for MBP Antibody (7D2)

  • Hmbpr
  • MBP
  • MGC99675
  • mld
  • Myelin A1 protein
  • myelin basic protein
  • Myelin membrane encephalitogenic protein
  • shi


Myelin Basic protein (MBP), along with myelin proteolipid protein (PLP/lipophilin), is the most abundant protein constituents of myelin membrane in the CNS cells. MBP plays a key role in both the formation as well as the stabilization of this compact multilayer arrangement of bilayers. MBP is a homodimer that can self-associates in the presence of lysolipid, and is localized in myelin membrane as peripheral membrane protein on the cytoplasmic side of myelin. MBP is found in CNS/PNS and after post-translational modifications (PTMs), at least 6 charge isomers are produced: C1 (most cationic/least modified form), C2, C3, C4, C5 and C6 (the least cationic form); and its potential PTMs includes - phosphorylation of serine or threonine residues, deamidation of glutamine or asparagine residues, citrullination and methylation of arginine residues. MBP phosphorylations are executed by TAOK2, VRK2, MAPK11, MAPK12, MAPK14 and MINK1. Citrullination and methylation modifications of MBP may lead to reduction in surface charge that follows its weakened attachment with myelin membranes and this mechanism has been proposed to be operative in demyelinating diseases such as chronical multiple sclerosis (MS), fulminating MS (Marburg disease) etc.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Bv, Ch, Eq, Gp, Hu, Mu, Po, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu, Rt
Applications: WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Rt
Applications: BA
Species: Hu
Applications: IHC
Species: Hu, Mu, Rt
Applications: ICC, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu, Mu, Rt
Applications: ICC, IHC, KO, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: ELISA
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Rt
Applications: B/N, CyTOF-ready, EM, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB

Publications for MBP Antibody (NBP1-05204)(3)

Reviews for MBP Antibody (NBP1-05204) (0)

There are no reviews for MBP Antibody (NBP1-05204). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MBP Antibody (NBP1-05204) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional MBP Products

Diseases for MBP Antibody (NBP1-05204)

Discover more about diseases related to MBP Antibody (NBP1-05204).

Pathways for MBP Antibody (NBP1-05204)

View related products by pathway.

PTMs for MBP Antibody (NBP1-05204)

Learn more about PTMs related to MBP Antibody (NBP1-05204).

Research Areas for MBP Antibody (NBP1-05204)

Find related products by research area.

Blogs on MBP

There are no specific blogs for MBP, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our MBP Antibody (7D2) and receive a gift card or discount.


Gene Symbol MBP