MBP Antibody (7D2)

Western Blot: MBP Antibody (7D2) [NBP1-05204] - Analysis of different tissue lysates using mouse mAb to MBP, NBP1-05204, dilution 1:10,000 in green: [1] protein standard (red), [2] rat brain, [3] rat spinal cord, [4] mouse brain, [5] mouse spinal cord, [6] cow spinal cord. Bands at 21.5kDa and 18.5kDa are the two larger transcripts from the MBP gene, showing that the epitope of this antibody depends on the sequence encoded by exon 2. Note that monoclonal NBP1-05203 binds all four rat MBP transcripts running at 21.5kDa, 18.5kDa, 17kDa and 14kDa, so that this antibody binds to the core sequence of human and rodent MBP.

Immunohistochemistry: MBP Antibody (7D2) [NBP1-05204] - Analysis rat brain hippocampal section stained with mouse mAb to myelin basic protein (MBP), NBP1-05204, dilution 1:5,000 in green, and costained with rabbit pAb to NF-M, RPCA-NF-M, dilution 1:2,000, in red. The MBP antibody stains myelin sheathes around axons, while the NF-M antibody labels dendrites and axons of neuronal cells.

• Reactivity: Hu, Mu, Rt, Po, Bv, Eq
• Applications: WB, ICC/IF, IHC
• Clone: 7D2
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Concentration: 1 mg/ml

MBP Antibody (7D2) Summary

• Immunogen: Purified myelin basic protein isolated from bovine brain, epitope maps to the peptide AEGQRPGFGYGGRASDYKSAHKGFKGVDAQGTLSKIFKLG, amino acids 145-184 of the human 21.5kDa sequence.
• Marker: Oligodendrocyte Marker, Myelin Marker
• Specificity: The MBP Antibody (7D2) antibody binds only the 21.5kDa and 18.5kDa rat MBP isotypes, but all four isotypes of human and bovine MBP.
• Isotype: IgG1
• Clonality: Monoclonal
• Host: Mouse
• Gene: MBP
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 1:1000
  • Immunohistochemistry 1:1000
  • Western Blot 1:5000-1:10000
• Application Notes: This Myelin Basic Protein (7D2) antibody is useful for Immunocytochemistry/Immunofluorescence and Western blot, where a band can be seen at ~21.5 kDa.
• Theoretical MW: 18.5/21.5 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: 50% PBS, 50% glycerol
• Preservative: 5mM Sodium Azide
• Concentration: 1 mg/ml
• Purity: Affinity purified

Alternate Names for MBP Antibody (7D2)

• Hmbpr
• MBP
• MGC99675
• mld
• Myelin A1 protein
• myelin basic protein
• Myelin membrane encephalitogenic protein
• shi

Background

Myelin Basic protein (MBP), along with myelin proteolipid protein (PLP/lipophilin), is the most abundant protein constituents of myelin membrane in the CNS cells. MBP plays a key role in both the formation as well as the stabilization of this compact multilayer arrangement of bilayers. MBP is a homodimer that can self-associates in the presence of lysolipid, and is localized in myelin membrane as peripheral membrane protein on the cytoplasmic side of myelin. MBP is found in CNS/PNS and after post-translational modifications (PTMs), at least 6 charge isomers are produced: C1 (most cationic/least modified form), C2, C3, C4, C5 and C6 (the least cationic form); and its potential PTMs includes - phosphorylation of serine or threonine residues, deamidation of glutamine or asparagine residues, citrullination and methylation of arginine residues. MBP phosphorylations are executed by TAOK2, VRK2, MAPK11, MAPK12, MAPK14 and MINK1. Citrullination and methylation modifications of MBP may lead to reduction in surface charge that follows its weakened attachment with myelin membranes and this mechanism has been proposed to be operative in demyelinating diseases such as chronical multiple sclerosis (MS), fulminating MS (Marburg disease) etc.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for MBP Antibody (NBP1-05204)(3)

Publications using NBP1-05204

• Xie Q, Zhang Y, Zhang J et al. Promotion effect of the blend containing 2'-FL, OPN and DHA on oligodendrocyte progenitor cells myelination in vitro Frontiers in nutrition 2022-11-10 [PMID: 36438761] (IF/IHC, Rat)
• Prukop T, Wernick S, Boussicault L et al. Synergistic PXT3003 therapy uncouples neuromuscular function from dysmyelination in male Charcot-Marie-Tooth disease type 1A (CMT1A) rats J. Neurosci. Res. 2020-06-26 [PMID: 32588471] (WB, Rat)
• Hauser J, Sultan S, Rytz A et al. A blend containing docosahexaenoic acid, arachidonic acid, vitamin B12, vitamin B9, iron and sphingomyelin promotes myelination in an in vitro model Nutr Neurosci 2019-02-26 [PMID: 30806182] (ICC/IF, Rat)

Bioinformatics

• Gene Symbol: MBP
• Entrez:
  • 24547(Rat)