MBNL3 Antibody

Images

 
Western Blot: MBNL3 Antibody [NBP1-85635] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: Hep-G2
Immunocytochemistry/ Immunofluorescence: MBNL3 Antibody [NBP1-85635] - Immunofluorescent staining of human cell line A-431 shows localization to the Golgi apparatus & vesicles.
Immunohistochemistry-Paraffin: MBNL3 Antibody [NBP1-85635] - Staining of human placenta shows nuclear positivity in trophoblastic cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MBNL3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:AQMSSLGSFPMTPSIPANPPMAFNPYIPHPGMGLVPAELVPNTPVLIPGNPPLAMPGAVGPKLMRSDKLEVCREFQRGNCTRGENDCRYAHPTDASMIEASDNTVTICMDYIKGRCSREKCKYFHPPAHLQARLKAAHHQMNHSAAS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MBNL3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MBNL3 Protein (NBP1-85635PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (82%), Rat (83%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MBNL3 Antibody

  • CHCRMBLX39FLJ11316
  • Cys3His CCG1-required protein
  • FLJ97142
  • MBXLMBLX
  • muscleblind-like 3 (Drosophila)
  • muscleblind-like protein 3
  • Muscleblind-like X-linked protein
  • Protein HCHCR

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-37256
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-79451
Species: Hu
Applications: WB
MAB6967
Species: Hu
Applications: WB
NB100-56510
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-42632
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
H00004205-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NB110-85519
Species: Hu, Mu
Applications: WB, ELISA, IHC, IP
NBP1-86562
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB200-412
Species: Hu, Mu, Rt, Ca
Applications: IA, S-ELISA
NBP1-22568
Species: Hu
Applications: IHC-P
NB100-56511
Species: Hu, Mu, Rt, Fe
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
NBP2-38512
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83801
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1774
Species: Hu, Rt, Am, Dr
Applications: WB, EM, ELISA, ICC/IF, IP
NBP2-12793
Species: Hu, Mu
Applications: WB, IP
NBP1-82952
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP
NBP1-85788
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-69124
Species: Mu, Rt
Applications: WB, IHC
NBP1-85635
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for MBNL3 Antibody (NBP1-85635) (0)

There are no publications for MBNL3 Antibody (NBP1-85635).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MBNL3 Antibody (NBP1-85635) (0)

There are no reviews for MBNL3 Antibody (NBP1-85635). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MBNL3 Antibody (NBP1-85635) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MBNL3 Products

Bioinformatics Tool for MBNL3 Antibody (NBP1-85635)

Discover related pathways, diseases and genes to MBNL3 Antibody (NBP1-85635). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MBNL3 Antibody (NBP1-85635)

Discover more about diseases related to MBNL3 Antibody (NBP1-85635).
 

Pathways for MBNL3 Antibody (NBP1-85635)

View related products by pathway.

Blogs on MBNL3

There are no specific blogs for MBNL3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MBNL3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MBNL3