MBL Antibody - BSA Free

Immunohistochemistry-Paraffin: MBL Antibody [NBP1-85518] - Analysis in human liver and prostate tissues using NBP1-85518 antibody. Corresponding MBL RNA-seq data are presented for the same tissues.

Western Blot: MBL Antibody [NBP1-85518] - Analysis in human liver tissue.

Immunohistochemistry-Paraffin: MBL Antibody [NBP1-85518] - Staining of human cervix, uterine shows no positivity in squamous epithelial cells as expected.

Immunohistochemistry-Paraffin: MBL Antibody [NBP1-85518] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.

Immunohistochemistry-Paraffin: MBL Antibody [NBP1-85518] - Staining of human cerebral cortex shows no positivity neurons as expected.

Immunohistochemistry-Paraffin: MBL Antibody [NBP1-85518] - Staining of human prostate shows positivity in glandular cells as expected.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

MBL Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: DGDSSLAASERKALQTEMARIKKWLTFSLGKQVGNKFFLTNGEIMTFEKVKALCVKFQASVATPRNAAENGAIQNLIKEEAFLGITDEKTEGQFVDLTGNRLTYTNWNEGEPNNAGSDEDCVLLLKNGQWNDVPCSTSH
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MBL2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  MBL Protein (NBP1-85518PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for MBL Antibody - BSA Free

• COLEC1
• COLEC1collectin-1
• Collectin-1
• HSMBPC
• Mannan-binding protein
• mannose-binding lectin (protein C) 2, soluble (opsonic defect)
• mannose-binding lectin (protein C) 2, soluble
• Mannose-binding lectin
• mannose-binding protein C
• MBL
• MBL2
• MBL2D
• MBLmannan-binding lectin
• MBP
• MBP1
• MBP1mannose-binding lectin 2, soluble (opsonic defect)
• MBP-C
• MGC116832
• MGC116833

Background

Mannose-binding lectin, MBL, belongs to the C-type family of collectins. It functions as an opsonin which activates the alternative pathway of the complement system on binding to microbial polysaccharides.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for MBL Antibody (NBP1-85518)(2)

Publications using NBP1-85518

• Singh KK, Nathamu S, Adame A et al. Expression of mannose binding lectin in HIV-1-infected brain: implications for HIV-related neuronal damage and neuroAIDS. Neurobehav HIV Med 2011-05-01 [PMID: 21852898]
• Matthijsen RA, de Winther MP, Kuipers D et al. Macrophage-specific expression of mannose-binding lectin controls atherosclerosis in low-density lipoprotein receptor-deficient mice. Circulation 2009-04-01 [PMID: 19380618]

FAQs for MBL Antibody (NBP1-85518). (Showing 1 - 1 of 1 FAQs).

1. We are working with the innate immune system of the squid Euprymna scolopes, and we are interested in characterizing the presence and patter of expression of MBL. We know that your company manufactures an antibody against MBL and we were wondering if you think that it may be used to identify the protein in the squid. I am attaching the sequence of the gene that encodes MBL in the squid as a reference for you to compare. Thanks a lot for your help. Squid C-type lectin: QDPRRHSCYYFNNATYLLSDKNLDWKETSKYCRRFHGHLPTPRNKVQVEFLSSNINWSNFNGQRYWIGLVGPSWTWSDGSPLTFANWGHKQPSPKIPGVDTCAYVNVAQQHKWEDMTCTEKKNTGA
   • I would not recommend using our product NBP1-85518 to detect your squid protein as the homology is very low.

Bioinformatics

• Gene Symbol: MBL2