Matrin 3 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: Matrin 3 Antibody [NBP3-38211] - Immunofluorescence analysis of C6 cells using Matrin 3 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunohistochemistry: Matrin 3 Antibody [NBP3-38211] - Immunohistochemistry analysis of paraffin-embedded Human esophageal using Matrin 3 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Immunohistochemistry: Matrin 3 Antibody [NBP3-38211] - Immunohistochemistry analysis of paraffin-embedded Rat testis using Matrin 3 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Immunocytochemistry/ Immunofluorescence: Matrin 3 Antibody [NBP3-38211] - Immunofluorescence analysis of NIH/3T3 cells using Matrin 3 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Western Blot: Matrin 3 Antibody [NBP3-38211] - Western blot analysis of various lysates using Matrin 3 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 10s.

Immunohistochemistry: Matrin 3 Antibody [NBP3-38211] - Immunohistochemistry analysis of paraffin-embedded Mouse brain using Matrin 3 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Immunocytochemistry/ Immunofluorescence: Matrin 3 Antibody [NBP3-38211] - Immunofluorescence analysis of U-2 OS cells using Matrin 3 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Matrin 3 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Matrin 3 Antibody - BSA Free (NBP3-38211) is a polyclonal antibody validated for use in IHC, WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 747-847 of human Matrin 3 (NP_001181884.1).
  
  Sequence:
  SSENADDPNKDTSENADGQSDENKDDYTIPDEYRIGPYQPNVPVGIDYVIPKTGFYCKLCSLFYTNEEVAKNTHCSSLPHYQKLKKFLNKLAEERRQKKET
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MATR3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:100 - 1:200
  • Western Blot 1:500 - 1:1000
• Theoretical MW: 95 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for Matrin 3 Antibody - BSA Free

• distal 2
• DKFZp686K0542
• DKFZp686K23100
• matrin 3
• matrin-3
• vocal cord and pharyngeal weakness with distal myopathy

Background

Matrin 3 is encoded by this gene is localized in the nuclear matrix. It may play a role in transcription or may interact with other nuclear matrix proteins to form the internal fibrogranular network. Two transcript variants encoding the same protein have been identified for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MATR3