Matrilin-1 Antibody


Immunohistochemistry-Paraffin: Matrilin-1 Antibody [NBP1-84433] - Staining of human soft tissue shows nuclear and cytoplasmic positivity in chondrocytes.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P

Order Details

Matrilin-1 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids:REIASEPVAEHYFYTADFKTINQIGKKLQKKICVEEDPCACESLVKFQAKVEGLLQALTRKLEAVSKRLAILENTVV
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Matrilin-1 Recombinant Protein Antigen (NBP1-84433PEP)
Read Publication using NBP1-84433.

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (87%), Rat (88%). Reactivity reported in scientific literature (PMID: 22083516)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Matrilin-1 Antibody

  • cartilage matrix protein
  • CMP
  • CRTM
  • MATN1
  • matrilin 1, cartilage matrix protein
  • Matrilin1
  • Matrilin-1


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
Species: Hu, Mu, Rt, Po, Bv, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu, Mu, Rt, Ch, Rb
Applications: WB, IHC, IHC-Fr, IHC-P, IF
Species: Hu
Applications: WB, Simple Western, IHC
Species: Hu
Applications: WB, ELISA

Publications for Matrilin-1 Antibody (NBP1-84433)(1)

Reviews for Matrilin-1 Antibody (NBP1-84433) (0)

There are no reviews for Matrilin-1 Antibody (NBP1-84433). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Matrilin-1 Antibody (NBP1-84433) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Matrilin-1 Products

Bioinformatics Tool for Matrilin-1 Antibody (NBP1-84433)

Discover related pathways, diseases and genes to Matrilin-1 Antibody (NBP1-84433). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Matrilin-1 Antibody (NBP1-84433)

Discover more about diseases related to Matrilin-1 Antibody (NBP1-84433).

Pathways for Matrilin-1 Antibody (NBP1-84433)

View related products by pathway.

Blogs on Matrilin-1

There are no specific blogs for Matrilin-1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Matrilin-1 Antibody and receive a gift card or discount.


Gene Symbol MATN1