MASTL Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: MASTL Antibody [NBP2-55023] - Staining of human cell line A-431 shows localization to nucleoplasm.

• Reactivity: Hu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

MASTL Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit MASTL Antibody - BSA Free (NBP2-55023) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: EVLKTLASKRNAVAFRSFNSHINASNNSEPSRMNMTSLDAMDISCAYSGSYPMAITPTQKRRSCMPHQTPNQIKSG
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MASTL
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  MASTL Recombinant Protein Antigen (NBP2-55023PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for MASTL Antibody - BSA Free

• FLJ14813EC 2.7.11.1
• Greatwall
• GW
• GWL
• hGWL
• MASTL
• MAST-L
• microtubule associated serine/threonine kinase-like
• Microtubule-associated serine/threonine-protein kinase-like
• RP11-85G18.2
• THC2
• THC2greatwall protein kinase

Background

MASTL (microtubule-associated serine/threonine-protein kinase-like) is an uncharacterized putative serine/threonine kinase which may be involved in megakaryocyte development. Defects in MASTL are the cause of thrombocytopenia type 2 (THC2) a disease characterized by decreased circulating platelets and increased potential for bleeding.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MASTL