MARK2 Antibody


Immunohistochemistry-Paraffin: MARK2 Antibody [NBP1-84848] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P

Order Details

MARK2 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: SIFSKFTSKFVRRNLNEPESKDRVETLRPHVVGSGGNDKEKEEFREAKPRSLRFTWSMKTTSSMEPNE
Specificity of human MARK2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
MARK2 Protein (NBP1-84848PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for MARK2 Antibody

  • EC 2.7.11
  • EC
  • ELKL motif kinase 1
  • ELKL motif kinase
  • EMK-1
  • EMK1PAR-1
  • MAP/microtubule affinity-regulating kinase 2MGC99619
  • PAR1 homolog
  • Par1b
  • Ser/Thr protein kinase PAR-1B
  • serine/threonine protein kinase EMK
  • serine/threonine-protein kinase MARK2


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB (-), IHC-P, ICC
Species: Hu
Applications: WB, ELISA
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF
Species: Mu
Applications: WB, Flow, IP, CyTOF-ready, ICC
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for MARK2 Antibody (NBP1-84848) (0)

There are no publications for MARK2 Antibody (NBP1-84848).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MARK2 Antibody (NBP1-84848) (0)

There are no reviews for MARK2 Antibody (NBP1-84848). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for MARK2 Antibody (NBP1-84848) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional MARK2 Products

Bioinformatics Tool for MARK2 Antibody (NBP1-84848)

Discover related pathways, diseases and genes to MARK2 Antibody (NBP1-84848). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MARK2 Antibody (NBP1-84848)

Discover more about diseases related to MARK2 Antibody (NBP1-84848).

Pathways for MARK2 Antibody (NBP1-84848)

View related products by pathway.

PTMs for MARK2 Antibody (NBP1-84848)

Learn more about PTMs related to MARK2 Antibody (NBP1-84848).

Research Areas for MARK2 Antibody (NBP1-84848)

Find related products by research area.

Blogs on MARK2

There are no specific blogs for MARK2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our MARK2 Antibody and receive a gift card or discount.


Gene Symbol MARK2