MARCO Antibody


Immunocytochemistry/ Immunofluorescence: MARCO Antibody [NBP2-39004] - Staining of human cell line HeLa shows localization to the Golgi apparatus. Antibody staining is shown in green.
Orthogonal Strategies: Immunohistochemistry-Paraffin: MARCO Antibody [NBP2-39004] - Staining in human lung and pancreas tissues. Corresponding MARCO RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: MARCO Antibody [NBP2-39004] - Staining of human liver shows strong positivity in Kupffer cells.
Immunohistochemistry-Paraffin: MARCO Antibody [NBP2-39004] - Staining of human lung shows strong positivity in macrophages.
Immunohistochemistry-Paraffin: MARCO Antibody [NBP2-39004] - Staining of human lymph node shows moderate membranous positivity.
Immunohistochemistry-Paraffin: MARCO Antibody [NBP2-39004] - Staining of human pancreas shows no positivity as expected.

Product Details

Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Validated by:

Orthogonal Strategies


Order Details

MARCO Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: LNLQARLRVLEMYFLNDTLAAEDSPSFSLLQSAHPGEHLAQGASRLQVLQAQLTWVRV
Specificity of human MARCO antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MARCO Protein (NBP2-39004PEP)
Reviewed Applications
Read 1 Review rated 5
NBP2-39004 in the following applications:

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for MARCO Antibody

  • macrophage receptor with collagenous structureSCARA2Scavenger receptor class A member 2
  • member 2
  • SCARA2


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, ICC/IF, IHC-Fr, PLA
Species: Hu, Mu, Rt, ChHa, SyHa, Ha, Md, Pm, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, CyTOF-ready, ELISA(Cap), Flow-CS, Flow-IC
Species: Hu, Mu, Rt, Po, Bv, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu
Species: Hu, Mu, Po, Vi
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, RIA
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for MARCO Antibody (NBP2-39004) (0)

There are no publications for MARCO Antibody (NBP2-39004).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for MARCO Antibody (NBP2-39004) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using NBP2-39004:
Filter by Applications
All Applications
Filter by Species
All Species
Images Ratings Applications Species Date Details
Immunocytochemistry MARCO NBP2-39004
reviewed by:
ICC Human 05/17/2016


Sample TestedLiver


Blocking Details5%BSA in PBS

Primary Anitbody

Dilution Ratio1:100

Secondary Antibody

Secondary Descriptiongoat anti-mouse or rabbit IgG


Detection Notesexposure 1min
Fixation DetailsEDTA 30MIN
Wash DescriptionWash with PBS 5min everytime,three times

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for MARCO Antibody (NBP2-39004) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for MARCO Antibody (NBP2-39004)

Discover related pathways, diseases and genes to MARCO Antibody (NBP2-39004). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MARCO Antibody (NBP2-39004)

Discover more about diseases related to MARCO Antibody (NBP2-39004).

Pathways for MARCO Antibody (NBP2-39004)

View related products by pathway.

PTMs for MARCO Antibody (NBP2-39004)

Learn more about PTMs related to MARCO Antibody (NBP2-39004).

Blogs on MARCO

There are no specific blogs for MARCO, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Recent Reviews


Application: ICC
Species: Human


Gene Symbol MARCO