MARCO Antibody

Images

 
Western Blot: MARCO Antibody [NBP2-39004] - Lane 1: Marker [kDa] 250, 130,100,70,55,35,25,15,10. Lane 2: Human Lung tissue
Immunocytochemistry/ Immunofluorescence: MARCO Antibody [NBP2-39004] - Immunofluorescent staining of human cell line HeLa shows localization to the Golgi apparatus.
Immunohistochemistry-Paraffin: MARCO Antibody [NBP2-39004] - Staining of human normal liver using anti-MARCO antibody. Image from verified customer review.
Immunohistochemistry-Paraffin: MARCO Antibody [NBP2-39004] - Staining of human lung shows strong positivity in macrophages.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MARCO Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: LNLQARLRVLEMYFLNDTLAAEDSPSFSLLQSAHPGEHLAQGASRLQVLQAQLTWVRV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MARCO
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:250 - 1:500
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
This product has been validated for use in IHC-Paraffin Embedded Tissues. HIER pH6 antigen retrieval is recommended.
Control Peptide
MARCO Protein (NBP2-39004PEP)
Reviewed Applications
Read 1 Review rated 5
using
NBP2-39004 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MARCO Antibody

  • macrophage receptor with collagenous structureSCARA2Scavenger receptor class A member 2
  • MARCO
  • member 2
  • SCARA2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-00092
Species: Hu, Mu
Applications: WB, ICC/IF, IHC-Fr
NB400-104
Species: Hu, Mu, Rt, ChHa, SyHa, Ha, Md, Pm, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-56566
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, CyTOF-ready, Flow-CS, Flow-IC
NB400-144
Species: Hu, Mu, Rt, Po, Bv, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NB100-683
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
AF5745
Species: Hu
Applications: WB, IHC
NBP1-84550
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF6387
Species: Hu
Applications: WB
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NLS1878
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-92684
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-88968
Species: Hu
Applications: WB, IHC, IHC-P
NB600-534
Species: Hu, Po, Vi
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, RIA
NBP2-39004
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for MARCO Antibody (NBP2-39004) (0)

There are no publications for MARCO Antibody (NBP2-39004).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for MARCO Antibody (NBP2-39004) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Human.
We have 1 review tested in 1 application: ICC.

Reviews using NBP2-39004:
Filter by Applications
ICC
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Immunocytochemistry MARCO NBP2-39004
Enlarge
reviewed by:
Anonymous
ICC Human 05/17/2016
View

Summary

ApplicationImmunocytochemistry
Sample TestedLiver
SpeciesHuman

Blocking

Blocking Details5%BSA in PBS

Primary Anitbody

Dilution Ratio1:100

Secondary Antibody

Secondary Descriptiongoat anti-mouse or rabbit IgG

Details

Detection Notesexposure 1min
Fixation DetailsEDTA 30MIN
Wash DescriptionWash with PBS 5min everytime,three times

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MARCO Antibody (NBP2-39004) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MARCO Products

Bioinformatics Tool for MARCO Antibody (NBP2-39004)

Discover related pathways, diseases and genes to MARCO Antibody (NBP2-39004). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MARCO Antibody (NBP2-39004)

Discover more about diseases related to MARCO Antibody (NBP2-39004).
 

Pathways for MARCO Antibody (NBP2-39004)

View related products by pathway.

PTMs for MARCO Antibody (NBP2-39004)

Learn more about PTMs related to MARCO Antibody (NBP2-39004).

Blogs on MARCO

There are no specific blogs for MARCO, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

Anonymous
05/17/2016
Application: ICC
Species: Human

Bioinformatics

Gene Symbol MARCO
Entrez
Uniprot