MARCO Antibody - BSA Free

Immunohistochemistry-Paraffin: MARCO Antibody [NBP2-39004] - Staining in human lung and pancreas tissues . Corresponding MARCO RNA-seq data are presented for the same tissues.

Immunohistochemistry: MARCO Antibody [NBP2-39004] - Staining in normal human liver. Image from a verified customer review.

Immunohistochemistry-Paraffin: MARCO Antibody [NBP2-39004] - Staining of human liver shows strong positivity in Kupffer cells.

Immunohistochemistry-Paraffin: MARCO Antibody [NBP2-39004] - Staining of human lung shows strong positivity in macrophages.

Immunohistochemistry-Paraffin: MARCO Antibody [NBP2-39004] - Staining of human lymph node shows moderate membranous positivity.

Immunohistochemistry-Paraffin: MARCO Antibody [NBP2-39004] - Staining of human pancreas shows no positivity as expected.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

MARCO Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit MARCO Antibody - BSA Free (NBP2-39004) is a polyclonal antibody validated for use in IHC. Anti-MARCO Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: LNLQARLRVLEMYFLNDTLAAEDSPSFSLLQSAHPGEHLAQGASRLQVLQAQLTWVRV
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MARCO
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  MARCO Protein (NBP2-39004PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for MARCO Antibody - BSA Free

• macrophage receptor with collagenous structureSCARA2Scavenger receptor class A member 2
• MARCO
• member 2
• SCARA2

Background

MARCO is a member of the class A scavenger receptor family and is part of the innate antimicrobial immune system. The protein may bind both Gram negative and Gram positive bacteria via an extracellular, C terminal, scavenger receptor cysteine rich (SRCR) domain. In addition to short cytoplasmic and transmembrane domains, there is an extracellular spacer domain and a long, extracellular collagenous domain. MARCO may form a trimeric molecule by the association of the collagenous domains of three identical polypeptide chains.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for MARCO Antibody (NBP2-39004)(1)

Publication using NBP2-39004

• Chen Y, Hao X, Li M et al. UGRP1-modulated MARCO+ alveolar macrophages contribute to age-related lung fibrosis Immunity & ageing : I & A 2023-03-18 [PMID: 36934284] (IHC-P, Human)

Review for MARCO Antibody (NBP2-39004) (1)

Average Rating: 5

(Based on 1 review)

We have 1 review tested in 1 species: Human.

reviewed by: Verified Customer ICC Human 05/17/2016

Summary

• Application: Immunocytochemistry
• Sample Tested: Liver
• Species: Human

Bioinformatics

• Gene Symbol: MARCO
• Uniprot:
  • Q9UEW3()