MAP4K5 Antibody

Images

 
Western Blot: MAP4K5 Antibody [NBP1-83385] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/ Immunofluorescence: MAP4K5 Antibody [NBP1-83385] - Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane & cytosol.
Immunohistochemistry-Paraffin: MAP4K5 Antibody [NBP1-83385] - Staining of human testis shows moderate positivity in a subset of cells in seminiferus ducts
Western Blot: MAP4K5 Antibody [NBP1-83385] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MAP4K5 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:YPEDNFPDEEKASTIKHCPDSESRAPQILRRQSSPSCGPVAETSSIGNGDGISKLMSENTEGSAQAPQLPRKKDKRDFPKPA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MAP4K5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MAP4K5 Protein (NBP1-83385PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (87%), Rat (82%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MAP4K5 Antibody

  • EC 2.7.11
  • EC 2.7.11.1
  • GCKR
  • germinal center kinase-related
  • KHS1
  • KHSMEKKK 5
  • Kinase homologous to SPS1/STE20
  • MAP4K5
  • MAPK/ERK kinase kinase kinase 5
  • MAPKKKK5
  • MEK kinase kinase 5
  • mitogen-activated protein kinase kinase kinase kinase 5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-47778
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-88584
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB400-139
Species: Hu, Ha
Applications: ICC/IF (-), WB, ELISA, Flow, IHC, IHC-P
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP1-57033
Species: Hu
Applications: WB
AF7197
Species: Hu, Mu
Applications: WB, IHC, ICC
NLS932
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P
NB100-56715
Species: Hu
Applications: WB, IHC, IHC-P
H00006934-M06
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-88057
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB1846
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP1-84312
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56077
Species: Hu
Applications: WB, IHC, IHC-P, IP
MAB4605
Species: Hu
Applications: WB, Simple Western, ICC, ICFlow
NB200-527
Species: Hu, Mu
Applications: WB
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-83385
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for MAP4K5 Antibody (NBP1-83385) (0)

There are no publications for MAP4K5 Antibody (NBP1-83385).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MAP4K5 Antibody (NBP1-83385) (0)

There are no reviews for MAP4K5 Antibody (NBP1-83385). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MAP4K5 Antibody (NBP1-83385) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MAP4K5 Products

Bioinformatics Tool for MAP4K5 Antibody (NBP1-83385)

Discover related pathways, diseases and genes to MAP4K5 Antibody (NBP1-83385). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MAP4K5 Antibody (NBP1-83385)

Discover more about diseases related to MAP4K5 Antibody (NBP1-83385).
 

Pathways for MAP4K5 Antibody (NBP1-83385)

View related products by pathway.

PTMs for MAP4K5 Antibody (NBP1-83385)

Learn more about PTMs related to MAP4K5 Antibody (NBP1-83385).
 

Research Areas for MAP4K5 Antibody (NBP1-83385)

Find related products by research area.

Blogs on MAP4K5

There are no specific blogs for MAP4K5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MAP4K5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MAP4K5
Entrez