MAP4K2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: MAP4K2 Antibody [NBP1-88584] - Immunofluorescent staining of human cell line A-431 shows localization to vesicles.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MAP4K2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:ETDPLNEPWEEEWTLLGKEELSGSLLQSVQEALEERSLTIRSASEFQELDSPDDTMGTIKRAPFLGPLPTDPPAEEPLSSPPGTLPPPPSGPNSSPLLPTAWATMKQRE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MAP4K2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MAP4K2 Protein (NBP1-88584PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MAP4K2 Antibody

  • B lymphocyte serine/threonine protein kinase
  • B lymphocyte serine/threonine-protein kinase
  • BL44
  • EC 2.7.11
  • EC 2.7.11.1
  • GC kinase
  • GCKMEK kinase kinase 2
  • Germinal center kinase
  • germinal centre kinase (GC kinase)
  • MAPK/ERK kinase kinase kinase 2
  • mitogen-activated protein kinase kinase kinase kinase 2
  • Rab8 interacting protein
  • Rab8-interacting protein
  • RAB8IPMEKKK 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
MAB4605
Species: Hu
Applications: WB, Simple Western, ICC, ICFlow
NBP1-33596
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-00206
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-59320
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC
NBP2-03396
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89680
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-22218
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF2419
Species: Hu
Applications: WB, Simple Western, IHC, ICC
NBP1-83385
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NLS932
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP1-80533
Species: Mu
Applications: WB
NBP2-16679
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-87833
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF2746
Species: Hu, Mu
Applications: WB, ICC
NBP1-88584
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for MAP4K2 Antibody (NBP1-88584) (0)

There are no publications for MAP4K2 Antibody (NBP1-88584).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MAP4K2 Antibody (NBP1-88584) (0)

There are no reviews for MAP4K2 Antibody (NBP1-88584). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for MAP4K2 Antibody (NBP1-88584) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MAP4K2 Products

Bioinformatics Tool for MAP4K2 Antibody (NBP1-88584)

Discover related pathways, diseases and genes to MAP4K2 Antibody (NBP1-88584). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MAP4K2 Antibody (NBP1-88584)

Discover more about diseases related to MAP4K2 Antibody (NBP1-88584).
 

Pathways for MAP4K2 Antibody (NBP1-88584)

View related products by pathway.

Research Areas for MAP4K2 Antibody (NBP1-88584)

Find related products by research area.

Blogs on MAP4K2

There are no specific blogs for MAP4K2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MAP4K2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MAP4K2