MAP2 Recombinant Protein Antigen

Images

 
There are currently no images for MAP2 Recombinant Protein Antigen (NBP2-61417PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

MAP2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MAP2.

Source: E. coli

Amino Acid Sequence: EAKAPHWTSAPLTEASAHSHPPEIKDQGGAGEGLVRSANGFPYREDEEGAFGEHGSQGTYSNTKENGINGELTSADRETAEEVSARIVQVVTAEAVAVLKGEQEKEAQHKDQTAALPLAAEETANLPPSPPPSPASEQTVT

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
MAP2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-61417.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for MAP2 Recombinant Protein Antigen

  • DKFZp686I2148
  • MAP2
  • MAP-2
  • MAP2A
  • MAP2B
  • MAP2C
  • Microtubule Associated Protein 2
  • microtubule-associated protein 2
  • MTAP2

Background

Microtubule-associated protein 2 also known as MAP2 (theoretical molecular weight 280 kDa) belongs to the MAP2/Tau family which in addition to the two neuronal forms MAP2 and Tau also includes MAP4 (1). For MAP2, four different isoforms have been identified which are produced through alternative splicing including MAP2a, MAP2b, MAP2c and MAP2d (1). MAP2 isoforms contain multiple microtubule-binding domains located near the carboxy terminal, a variably sized amino-terminal projection domain, and a conserved protein kinase A binding domain. MAP2c and MAP2d isoforms have a shorter amino-terminal projection domain, lower molecular weight and are identifiable at ~70 kDa in SDS-PAGE analysis (2,3). MAP2's carboxy terminal domain supports interactions with microtubules, actin, and intermediate filaments (2).

MAP2 isoforms are developmentally regulated and differentially expressed in neurons and some glia. MAP2c is predominantly expressed in the developing brain while the other isoforms are expressed in the adult brain. The distribution of MAP2 isoforms also varies, with MAP2a and MAP2b predominantly localized to dendrites, while MAP2c is also found in axons. Lastly, the expression of MAP2d is not limited to neurons and may be found in glia, specifically oligodendrocytes (1, 2). MAP2 isoforms associate with microtubules and mediate their interaction with actin filaments thereby playing a critical role in organizing the microtubule-actin network. In neurons, MAP2 isoforms are implicated in different processes including neurite initiation, elongation and stabilization as well as axon and dendrite formation (2). Knockout of MAP expression in animal models results in a variety of functional and structural brain defects according to the isoform affected (e.g., reduced LTP and LTD, reduced myelination, absence of corpus collosum, motor system malfunction, abnormal hippocampal dendritic morphology, abnormal synaptic plasticity) (4).

References

1. Dehmelt, L., & Halpain, S. (2005). The MAP2/Tau family of microtubule-associated proteins. Genome Biology. https://doi.org/10.1186/gb-2004-6-1-204

2. Mohan, R., & John, A. (2015). Microtubule-associated proteins as direct crosslinkers of actin filaments and microtubules. IUBMB Life. https://doi.org/10.1002/iub.1384

3. Shafit-Zagardo, B., & Kalcheva, N. (1998). Making sense of the multiple MAP-2 transcripts and their role in the neuron. Molecular Neurobiology. https://doi.org/10.1007/BF02740642

4. Tortosa, E., Kapitein, L. C., & Hoogenraad, C. C. (2016). Microtubule organization and microtubule-associated proteins (MAPs). In Dendrites: Development and Disease. https://doi.org/10.1007/978-4-431-56050-0_3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-141
Species: Bv, Ch, Eq, Gp, Hu, Mu, Po, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
NBP2-67702
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP2-13304
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NB300-653
Species: Ch, Fe, Hu, Pm, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
MAB1259
Species: Hu
Applications: CyTOF-reported, ICC, ICFlow
NBP1-42827
Species: Ch, Fi, Hu, Pm, Mu, Rt, Re, Xp
Applications: ICC/IF, IHC, IHC-Fr, WB
DBD00
Species: Hu
Applications: ELISA
NBP1-88191
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
H00064112-M02
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
233-FB
Species: Hu
Applications: BA
NB600-717
Species: Bv
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, RIA, RI, WB
NB110-58870
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KD, Simple Western, WB
AF1724
Species: Hu
Applications: IP, WB
NB300-223
Species: Bv, Ca, Ch, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
236-EG
Species: Hu
Applications: BA
NBP2-14871
Species: Mu, Rt
Applications: ICC/IF, WB
DYC1825-2
Species: Hu, Mu, Rt
Applications: ELISA
NB300-109
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr,  IHC-P, KO, Simple Western, WB

Publications for MAP2 Recombinant Protein Antigen (NBP2-61417PEP) (0)

There are no publications for MAP2 Recombinant Protein Antigen (NBP2-61417PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MAP2 Recombinant Protein Antigen (NBP2-61417PEP) (0)

There are no reviews for MAP2 Recombinant Protein Antigen (NBP2-61417PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for MAP2 Recombinant Protein Antigen (NBP2-61417PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MAP2 Products

Research Areas for MAP2 Recombinant Protein Antigen (NBP2-61417PEP)

Find related products by research area.

Blogs on MAP2.

Methamphetamine with HIV induces mitochondrial dysfunction and neuronal injury through oxidative stress
By Jamshed Arslan, Pharm. D., PhD. December 1 is the World AIDS Day. Despite the combination antiretroviral therapy, 10-25% of Human Immunodeficiency Virus (HIV)-positive individuals report neurocognitive impairm...  Read full blog post.

Deriving neural precursor cells from human induced pluripotent stem cells
By Jennifer Sokolowski, MD, PhD.Human induced pluripotent stem cells (iPSCs) can be used to create models of human organ systems and are useful for a) ascertaining the mechanisms underlying pathological conditions...  Read full blog post.

Losing memory: Toxicity from mutant APP and amyloid beta explain the hippocampal neuronal damage in Alzheimer's disease
 By Jamshed Arslan Pharm.D.  Alzheimer's disease (AD) is an irreversible brain disorder that destroys memory and thinking skills. The telltale signs of AD brains are extracellular deposits of amy...  Read full blog post.

Beta Tubulin III and neurogenesis
Beta tubulin III, also known as Tuj-1, is a class III member of the beta tubulin protein family. Beta tubulins are one of two structural components that form our microtubule network. While general tubulins play a role in a wide range of cellular pr...  Read full blog post.

Synapsin I: Implicated in synaptic activity across a diverse range of studies
Synapsins are a family of neuronal proteins that are most renowned for their activity in modulating the pre-synaptic terminal.  Synapsin’s behavior is regulated by protein kinases and phosphatases, which alter the way that synapsin’s i...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our MAP2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol MAP2