MAN1C1 Antibody - BSA Free

Western Blot: MAN1C1 Antibody [NBP2-87773] - Host: Rabbit. Target Name: Man1c1. Sample Type: Mouse Testis lysates. Antibody Dilution: 1.0ug/ml

• Reactivity: Mu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

MAN1C1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit MAN1C1 Antibody - BSA Free (NBP2-87773) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse MAN1C1. Peptide sequence: ESYMYLWRQTHDPIYREWGWEVVMALEKHCRTEAGFSGIQDVYSSNPNHD The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MAN1C1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for MAN1C1 Antibody - BSA Free

• 1,2-alpha-mannosidase IC
• Alpha-1,2-mannosidase IC
• EC 3.2.1.113
• HMICProcessing alpha-1,2-mannosidase IC
• MAN1A3
• MAN1C
• Mannosidase alpha class 1C member 1
• mannosidase, alpha, class 1C, member 1
• mannosyl-oligosaccharide 1,2-alpha-mannosidase IC
• pp6318

Background

Mannosidases are divided into two subtypes; I and II, (EC numbers 3.2.1.113 and 3.2.1.114 respectively) which display awide expression pattern. Mannosidase I hydrolyzes (1,2)-linked alpha-D-mannose residues in the oligo-mannoseoligosaccharide Man9(GlcNAc)2 and mannosidase II hydrolyzes (1,3)- and (1,6)-linked alpha-D-mannose residues inMan5(GlcNAc)3. Both subtypes require a divalent cation cofactor. Mutations in mannosidases can cause mannosidosis(mannosidase I deficiency).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MAN1C1