MAL Antibody

Images

 
Western Blot: MAL Antibody [H00004118-B01P] - Analysis of MAL expression in transfected 293T cell line by MAL polyclonal antibody. Lane 1: MAL transfected lysate(16.94 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

MAL Antibody Summary

Immunogen
MAL (AAH00458, 1 a.a. - 153 a.a.) full-length human protein. MAPAAATGGSTLPSGFSVFTTLPDLLFIFEFIFGGLVWILVASSLVPWPLVQGWVMFVSVFCFVATTTLIILYIIGAHGGETSWVTLDAAYHCTAALFYLSASVLEALATITMQDGFTYRHYHENIAAVVFSYIATLLYVVHAVFSLIRWKSS
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
MAL
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
It has been used for WB and Functional.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MAL Antibody

  • mal, T-cell differentiation protein
  • myelin and lymphocyte protein
  • T-cell differentiation protein MAL
  • T-lymphocyte maturation-associated protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56566
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, CyTOF-ready, Flow-CS, Flow-IC
NBP2-29328
Species: Hu, Mu, Rt, Xp, Ye, Ze
Applications: ELISA
NB100-56722
Species: Hu, Ca
Applications: WB, B/N, Flow, Func, ICC/IF, IHC-P, IP, Flow-CS
NB120-13810
Species: Hu, Mu, Rt, Po
Applications: WB, Simple Western, IB, ICC/IF, IP
NBP1-87814
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF4348
Species: Hu, Mu, Rt
Applications: WB, CyTOF-ready, ICC, ICFlow
NBP1-88498
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13351
Species: Hu, ChHa
Applications: WB, IHC, IHC-P
NB100-65214
Species: Hu, Mu, Rt, Ma
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-42073
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF3646
Species: Hu
Applications: WB, ICC
NBP2-24875
Species: Hu, Mu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP1-80669
Species: Hu
Applications: IHC, IHC-P
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NBP2-27184
Species: Hu, Mu, Ca, Eq
Applications: WB, ICC/IF
NBL1-12830
Species: Hu
H00004118-B01P
Species: Hu
Applications: WB

Publications for MAL Antibody (H00004118-B01P) (0)

There are no publications for MAL Antibody (H00004118-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MAL Antibody (H00004118-B01P) (0)

There are no reviews for MAL Antibody (H00004118-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MAL Antibody (H00004118-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MAL Products

Bioinformatics Tool for MAL Antibody (H00004118-B01P)

Discover related pathways, diseases and genes to MAL Antibody (H00004118-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MAL Antibody (H00004118-B01P)

Discover more about diseases related to MAL Antibody (H00004118-B01P).
 

Pathways for MAL Antibody (H00004118-B01P)

View related products by pathway.

PTMs for MAL Antibody (H00004118-B01P)

Learn more about PTMs related to MAL Antibody (H00004118-B01P).
 

Research Areas for MAL Antibody (H00004118-B01P)

Find related products by research area.

Blogs on MAL

There are no specific blogs for MAL, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MAL Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MAL
Uniprot