MAGEA11 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: MAGEA11 Antibody [NBP2-55827] - Staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.

• Reactivity: Hu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

MAGEA11 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit MAGEA11 Antibody - BSA Free (NBP2-55827) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PSTSPDLIDPESFSQDILHDKIIDLVHLLLRKYRVKGLITKAEM
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MAGEA11
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  MAGEA11 Recombinant Protein Antigen (NBP2-55827PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for MAGEA11 Antibody - BSA Free

• Cancer/testis antigen 1.11
• CT1.11
• CT1.11MAGE-11 antigen
• MAGE-11 antigen
• MAGE11
• MAGE11member 11
• MAGEA11
• MAGEA-11
• melanoma antigen family A, 11
• melanoma-associated antigen 11
• MGC10511

Background

MAGEA11 is a member of the MAGEA gene family. The members of this family encode proteins with 50 to 80% sequence identity to each other. The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEA genes are clustered at chromosomal location Xq28. They have been implicated in some hereditary disorders, such as dyskeratosis congenita. Two transcript variants encoding different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MAGEA11