MAGEA11 Antibody - Azide and BSA Free

Western Blot: MAGEA11 Antibody [H00004110-D01P] - Analysis of MAGEA11 expression in transfected 293T cell line by MAGEA11 rabbit polyclonal antibody.Lane 1: MAGEA11 transfected lysate(35.50 KDa).Lane 2: Non-transfected lysate.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

MAGEA11 Antibody - Azide and BSA Free Summary

• Description: Quality control test: Antibody reactive against mammalian transfected lysate.
• Immunogen: MAGEA11 (ENSP00000359445, 1 a.a. - 319 a.a.) full-length human protein. MPLEQRSQHCKPEEGLQAQEEDLGLVGAQALQAEEQEAAFFSSTLNVGTLEELPAAESPSPPQSPQEESFSPTAMDAIFGSLSDEGSGSQEKEGPSTSPDLIDPESFSQDILHDKIIDLVHLLLRKYRVKGLITKAEMLGSVIKNYEDYFPEIFREASVCMQLLFGIDVKEVDPTSHSYVLVTSLNLSYDGIQCNEQSMPKSGLLIIVLGVIFMEGNCIPEEVMWEVLSIMGVYAGREHFLFGEPKRLLTQNWVQEKYLVYRQVPGTDPACYEFLWGPRAHAETSKMKVLEYIANANGRDPTSYPSLYEDALREEGEGV
• Specificity: MAGEA11 - melanoma antigen family A, 11,
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MAGEA11
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MAGEA11 Antibody - Azide and BSA Free

• Cancer/testis antigen 1.11
• CT1.11
• CT1.11MAGE-11 antigen
• MAGE-11 antigen
• MAGE11
• MAGE11member 11
• MAGEA11
• MAGEA-11
• melanoma antigen family A, 11
• melanoma-associated antigen 11
• MGC10511

Background

This gene is a member of the MAGEA gene family. The members of this family encode proteins with 50 to 80% sequence identity to each other. The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEA genes are clustered at chromosomal location Xq28. They have been implicated in some hereditary disorders, such as dyskeratosis congenita. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MAGEA11
• Entrez:
  • 4110(Human)
• Uniprot:
  • ENSP00000359445(Human)