MAD2L1 Antibody

Images

 
Western Blot: MAD2L1 Antibody [NBP1-83185] - Lane 1: Marker [kDa] 230, 110, 82, 49, 32, 26, 18. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: MAD2L1 Antibody [NBP1-83185] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: MAD2L1 Antibody [NBP1-83185] - Staining of human kidney shows strong cytoplasmic positivity in distal tubules.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MAD2L1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:NNVVEQLKDWLYKCSVQKLVVVISNIESGEVLERWQFDIECDKTAKDDSAPREKSQKAIQDEIRSVIRQITATVTFLPLLEVSCSFDLLIYTDKDLVVPEKWEESGPQFITNSEEVRLRSFTTTIH
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MAD2L1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MAD2L1 Protein (NBP1-83185PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MAD2L1 Antibody

  • HSMAD2
  • MAD2 (mitotic arrest deficient, yeast, homolog)-like 1
  • MAD2 mitotic arrest deficient-like 1 (yeast)
  • MAD2L1
  • MAD2-like protein 1
  • MAD2mitotic arrest deficient, yeast, homolog-like 1
  • Mitotic arrest deficient 2-like protein 1
  • mitotic spindle assembly checkpoint protein MAD2A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32775
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NB100-59828
Species: Hu, Mu
Applications: WB, IHC-P, IP, PLA
NB100-353
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IP, CyTOF-ready
NBP1-89979
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF4885
Species: Mu
Applications: WB, IP
H00000699-D01P
Species: Hu, Mu
Applications: WB, ICC/IF, PLA
NBP1-81765
Species: Hu
Applications: IHC, IHC-P
NBP1-88517
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF6028
Species: Hu
Applications: WB, IHC
NB100-1103
Species: Hu
Applications: WB, PEP-ELISA
NBP2-20287
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
MAB6000
Species: Hu
Applications: ICC/IF (-), WB, Flow, IHC, CyTOF-ready
H00010459-D01P
Species: Hu
Applications: WB, ELISA
NBP1-82875
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-77836
Species: Hu, Mu, Rt, Po, Bv, Ch, Xp, Ze
Applications: WB, ELISA, Flow, IHC, IHC-P
NB100-1116
Species: Hu
Applications: ICC/IF, IHC, IHC-P, PEP-ELISA
NB100-56507
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NB100-547
Species: Hu
Applications: WB, ICC/IF, IP, PLA

Publications for MAD2L1 Antibody (NBP1-83185) (0)

There are no publications for MAD2L1 Antibody (NBP1-83185).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MAD2L1 Antibody (NBP1-83185) (0)

There are no reviews for MAD2L1 Antibody (NBP1-83185). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MAD2L1 Antibody (NBP1-83185) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MAD2L1 Products

Bioinformatics Tool for MAD2L1 Antibody (NBP1-83185)

Discover related pathways, diseases and genes to MAD2L1 Antibody (NBP1-83185). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MAD2L1 Antibody (NBP1-83185)

Discover more about diseases related to MAD2L1 Antibody (NBP1-83185).
 

Pathways for MAD2L1 Antibody (NBP1-83185)

View related products by pathway.

PTMs for MAD2L1 Antibody (NBP1-83185)

Learn more about PTMs related to MAD2L1 Antibody (NBP1-83185).
 

Research Areas for MAD2L1 Antibody (NBP1-83185)

Find related products by research area.

Blogs on MAD2L1

There are no specific blogs for MAD2L1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MAD2L1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MAD2L1
Entrez