MAD2L1 Antibody

Images

 
Western Blot: MAD2L1 Antibody [NBP1-83185] - Lane 1: Marker [kDa] 230, 110, 82, 49, 32, 26, 18. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: MAD2L1 Antibody [NBP1-83185] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: MAD2L1 Antibody [NBP1-83185] - Staining of human kidney shows strong cytoplasmic positivity in distal tubules.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MAD2L1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: NNVVEQLKDWLYKCSVQKLVVVISNIESGEVLERWQFDIECDKTAKDDSAPREKSQKAIQDEIRSVIRQITATVTFLPLLEVSCSFDLLIYTDKDLVVPEKWEESGPQFITNSEEVRLRSFTTTIH
Predicted Species
Mouse (94%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MAD2L1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MAD2L1 Protein (NBP1-83185PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MAD2L1 Antibody

  • HSMAD2
  • MAD2 (mitotic arrest deficient, yeast, homolog)-like 1
  • MAD2 mitotic arrest deficient-like 1 (yeast)
  • MAD2L1
  • MAD2-like protein 1
  • MAD2mitotic arrest deficient, yeast, homolog-like 1
  • Mitotic arrest deficient 2-like protein 1
  • mitotic spindle assembly checkpoint protein MAD2A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32775
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, WB
NB100-59828
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
NB100-353
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC/IF, IP, WB
NBP2-85249
Species: Hu, Mu
Applications: WB
NB100-91662
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-66987
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
H00000699-D01P
Species: Hu, Mu
Applications: ICC/IF, PLA, WB
NBP3-12270
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, WB
NBP1-88517
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KD, WB
MAB6028
Species: Hu
Applications: WB
NB100-1103
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
NBP2-75659
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
AF6000
Species: Hu, Mu
Applications: IHC, Simple Western, WB
NBP3-16451
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-82875
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-56479
Species: Bv, Ca, Hu, Mu, Po, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP3-15929
Species: Hu, Mu, Rt
Applications: WB
NB100-56507
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, IP, KO, Simple Western, WB
NBP1-48291
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, IP, WB

Publications for MAD2L1 Antibody (NBP1-83185) (0)

There are no publications for MAD2L1 Antibody (NBP1-83185).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MAD2L1 Antibody (NBP1-83185) (0)

There are no reviews for MAD2L1 Antibody (NBP1-83185). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MAD2L1 Antibody (NBP1-83185) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MAD2L1 Products

Bioinformatics Tool for MAD2L1 Antibody (NBP1-83185)

Discover related pathways, diseases and genes to MAD2L1 Antibody (NBP1-83185). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MAD2L1 Antibody (NBP1-83185)

Discover more about diseases related to MAD2L1 Antibody (NBP1-83185).
 

Pathways for MAD2L1 Antibody (NBP1-83185)

View related products by pathway.

PTMs for MAD2L1 Antibody (NBP1-83185)

Learn more about PTMs related to MAD2L1 Antibody (NBP1-83185).
 

Research Areas for MAD2L1 Antibody (NBP1-83185)

Find related products by research area.

Blogs on MAD2L1

There are no specific blogs for MAD2L1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MAD2L1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MAD2L1