MAD2L2 Antibody (7B6I2)

Western Blot: MAD2L2 Antibody (7B6I2) [NBP3-16451] - Western blot analysis of extracts of various cell lines, using MAD2B/MAD2L2 Rabbit mAb (NBP3-16451) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 90s.

Immunocytochemistry/Immunofluorescence: MAD2L2 Antibody (7B6I2) [NBP3-16451] - Immunofluorescence analysis of NIH-3T3 cells using MAD2B/MAD2L2 Rabbit mAb (NBP3-16451) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunohistochemistry-Paraffin: MAD2L2 Antibody (7B6I2) [NBP3-16451] - Immunohistochemistry of paraffin-embedded mouse brain using MAD2B/MAD2L2 Rabbit mAb (NBP3-16451) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunocytochemistry/Immunofluorescence: MAD2L2 Antibody (7B6I2) [NBP3-16451] - Immunofluorescence analysis of C6 cells using MAD2B/MAD2L2 Rabbit mAb (NBP3-16451) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunohistochemistry-Paraffin: MAD2L2 Antibody (7B6I2) [NBP3-16451] - Immunohistochemistry of paraffin-embedded rat brain using MAD2B/MAD2L2 Rabbit mAb (NBP3-16451) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunohistochemistry-Paraffin: MAD2L2 Antibody (7B6I2) [NBP3-16451] - Immunohistochemistry of paraffin-embedded human colon using MAD2B/MAD2L2 Rabbit mAb (NBP3-16451) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, ICC/IF, IHC
• Clone: 7B6I2
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

MAD2L2 Antibody (7B6I2) Summary

• Description: Novus Biologicals Rabbit MAD2L2 Antibody (7B6I2) (NBP3-16451) is a recombinant monoclonal antibody validated for use in IHC, WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 100-200 of human MAD2B/MAD2L2 (Q9UI95). FEITQPPLLSISSDSLLSHVEQLLRAFILKISVCDAVLDHNPPGCTFTVLVHTREAATRNMEKIQVIKDFPWILADEQDVHMHDPRLIPLKTMTSDILKMQ
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: MAD2L2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 ug/mL
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500 - 1:1000
• Theoretical MW: 24 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for MAD2L2 Antibody (7B6I2)

• hREV7
• MAD2 mitotic arrest deficient-like 2 (yeast)
• MAD2BREV7 homolog
• MAD2-like protein 2
• Mitotic arrest deficient 2-like protein 2
• mitotic arrest deficient homolog-like 2
• mitotic spindle assembly checkpoint protein MAD2B
• REV7yeast, homolog)-like 2

Background

MAD2L2 is a component of the mitotic spindle assembly checkpoint that prevents the onset of anaphase until all chromosomes are properly aligned at the metaphase plate. MAD2L2 is a homolog of MAD2L1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MAD2L2