CENPE Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: CENPE Antibody [NBP1-82875] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol & microtubules.
Immunohistochemistry-Paraffin: CENPE Antibody [NBP1-82875] - Staining of human stomach, upper shows strong nuclear positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CENPE Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:EKIENLTRMLVTSSSLTLQQELKAKRKRRVTWCLGKINKMKNSNYADQFNIPTNITTKTHKLSINLLREIDESVCSESDVFSNTLDTLSEIEWNPATKLLNQENIESELNSLRADYDN
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CENPE
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:1000-1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CENPE Protein (NBP1-82875PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CENPE Antibody

  • CENP-E
  • Centromere autoantigen E (312kD)
  • centromere protein E (312kD)
  • Centromere protein E
  • centromere protein E, 312kDa
  • centromere-associated protein E
  • KIF10
  • kinesin family member 10
  • Kinesin-related protein CENPE

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-563
Species: Hu
Applications: WB, IHC-P, IP
NB100-353
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IP, CyTOF-ready
AF4185
Species: Hu
Applications: ICC
NB100-2369
Species: Hu
Applications: ICC/IF, IHC
NBP2-55474
Species: Hu
Applications: ICC/IF
NBP2-12892
Species: Hu
Applications: WB, ICC/IF
NBP1-32775
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NB500-101
Species: Hu, Bv
Applications: WB, Flow, ICC/IF, IP
NBP2-01064
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00000699-D01P
Species: Hu, Mu
Applications: WB, ICC/IF, PLA
NB100-338
Species: Hu, Mu, Rt, Po, Ha, Mk
Applications: WB, Flow, ICC/IF, IHC, IP
NBP1-88517
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-294
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP, MiAr
NB500-181
Species: Hu, Mu, Rt, Po, Dr
Applications: WB, ICC/IF, IP
NBP2-37471
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP1-89979
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF4885
Species: Mu
Applications: WB, IP
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for CENPE Antibody (NBP1-82875) (0)

There are no publications for CENPE Antibody (NBP1-82875).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CENPE Antibody (NBP1-82875) (0)

There are no reviews for CENPE Antibody (NBP1-82875). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for CENPE Antibody (NBP1-82875) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CENPE Products

CENPE NBP1-82875

Bioinformatics Tool for CENPE Antibody (NBP1-82875)

Discover related pathways, diseases and genes to CENPE Antibody (NBP1-82875). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CENPE Antibody (NBP1-82875)

Discover more about diseases related to CENPE Antibody (NBP1-82875).
 

Pathways for CENPE Antibody (NBP1-82875)

View related products by pathway.

PTMs for CENPE Antibody (NBP1-82875)

Learn more about PTMs related to CENPE Antibody (NBP1-82875).
 

Research Areas for CENPE Antibody (NBP1-82875)

Find related products by research area.

Blogs on CENPE.

CENPF Antibodies as Potential Cancer Markers
Centromere protein F (CENPF), also named mitosin, is a large human protein of 3113 amino acid residues. Its expression and localization are cell cycle-dependent. The protein levels are low in G1 phase but elevated from S to early M phase. CENPF is a n...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CENPE Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CENPE