MAD2L1 Antibody (5W5U1)

Western Blot: MAD2L1 Antibody (5W5U1) [NBP3-15384] - Western blot analysis of extracts of various cell lines, using MAD2/MAD2L1 Rabbit mAb (NBP3-15384) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3min.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 5W5U1
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

MAD2L1 Antibody (5W5U1) Summary

• Description: Novus Biologicals Rabbit MAD2L1 Antibody (5W5U1) (NBP3-15384) is a recombinant monoclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 70-150 of human MAD2L1 (Q13257). EQLKDWLYKCSVQKLVVVISNIESGEVLERWQFDIECDKTAKDDSAPREKSQKAIQDEIRSVIRQITATVTFLPLLEVSCS
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: MAD2L1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 μg/mL
  • Western Blot 1:1000 - 1:2000
• Theoretical MW: 24 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for MAD2L1 Antibody (5W5U1)

• HSMAD2
• MAD2 (mitotic arrest deficient, yeast, homolog)-like 1
• MAD2 mitotic arrest deficient-like 1 (yeast)
• MAD2L1
• MAD2-like protein 1
• MAD2mitotic arrest deficient, yeast, homolog-like 1
• Mitotic arrest deficient 2-like protein 1
• mitotic spindle assembly checkpoint protein MAD2A

Background

The spindle checkpoint ensures the fidelity of chromosome segregation in mitosis and meiosis. In response to defects in the mitotic apparatus, it blocks the activity of the anaphase-promoting complex, a large ubiquitin ligase required for chromosome segregation. Recent studies indicate that the spindle checkpoint monitors both the attachment of chromosomes to the mitotic spindle and the tension across the sister chromatid generated by microtubules. Upon checkpoint activation, checkpoint protein complexes containing BubR1(Mad3), Bub3, Mad2 and Cdc20 directly bind to the anaphase-promoting complex and inhibit its ligase activity. Therefore, the checkpoint proteins form a complex intracellular signalling network to inhibit the anaphase-promoting complex.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MAD2L1