MAD1L1/MAD1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: MAD1L1/MAD1 Antibody [NBP1-89664] - Immunofluorescent staining of human cell line A-431 shows localization to nucleus & actin filaments.
Immunohistochemistry-Paraffin: MAD1L1/MAD1 Antibody [NBP1-89664] - Staining of human cerebral cortex shows strong nuclear positivity in neuronal cells and glial cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MAD1L1/MAD1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:TKVLHMSLNPTSVARQRLREDHSQLQAECERLRGLLRAMERGGTVPADLEAAAASLPSSKEVAELKKQVESAELKNQRLKEVFQTKIQEFRKACYTLTGYQIDITTENQYRLTSLYAEHPGDCLIFKATSPSGSKMQLLEIRRAPPLSNN
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MAD1L1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MAD1L1/MAD1 Protein (NBP1-89664PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MAD1L1/MAD1 Antibody

  • hMAD1
  • HsMAD1
  • MAD1 mitotic arrest deficient-like 1 (yeast)
  • MAD1
  • MAD1L1
  • MAD1-like protein 1
  • MAD1yeast, homolog-like 1
  • Mitotic checkpoint MAD1 protein homolog
  • PIG9
  • Tax-binding protein 181
  • TP53I9
  • tumor protein p53 inducible protein 9
  • TXBP181
  • TXBP181MAD1 (mitotic arrest deficient, yeast, homolog)-like 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-563
Species: Hu
Applications: WB, IHC-P, IP
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
AF4185
Species: Hu
Applications: ICC
NBP1-89979
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-793
Species: Hu
Applications: WB, PEP-ELISA
NBP2-24509
Species: Hu, Mu, Rt, Bv, Ca, Pm
Applications: WB, IHC-P
NB100-59828
Species: Hu, Mu
Applications: WB, IHC-P, IP, PLA
AF6028
Species: Hu
Applications: WB, IHC
H00000699-D01P
Species: Hu, Mu
Applications: WB, ICC/IF, PLA
NBP1-77836
Species: Hu, Mu, Rt, Po, Bv, Ch, Xp, Ze
Applications: WB, ELISA, Flow, IHC, IHC-P
NB100-56507
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP1-88517
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1116
Species: Hu
Applications: ICC/IF, IHC, IHC-P, PEP-ELISA
NB100-1103
Species: Hu
Applications: WB, PEP-ELISA
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81765
Species: Hu
Applications: IHC, IHC-P
NB100-353
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IP, CyTOF-ready
AF4885
Species: Mu
Applications: WB, IP
NB100-317
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-89664
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for MAD1L1/MAD1 Antibody (NBP1-89664) (0)

There are no publications for MAD1L1/MAD1 Antibody (NBP1-89664).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MAD1L1/MAD1 Antibody (NBP1-89664) (0)

There are no reviews for MAD1L1/MAD1 Antibody (NBP1-89664). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for MAD1L1/MAD1 Antibody (NBP1-89664) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MAD1L1/MAD1 Products

Bioinformatics Tool for MAD1L1/MAD1 Antibody (NBP1-89664)

Discover related pathways, diseases and genes to MAD1L1/MAD1 Antibody (NBP1-89664). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MAD1L1/MAD1 Antibody (NBP1-89664)

Discover more about diseases related to MAD1L1/MAD1 Antibody (NBP1-89664).
 

Pathways for MAD1L1/MAD1 Antibody (NBP1-89664)

View related products by pathway.

PTMs for MAD1L1/MAD1 Antibody (NBP1-89664)

Learn more about PTMs related to MAD1L1/MAD1 Antibody (NBP1-89664).
 

Research Areas for MAD1L1/MAD1 Antibody (NBP1-89664)

Find related products by research area.

Blogs on MAD1L1/MAD1

There are no specific blogs for MAD1L1/MAD1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MAD1L1/MAD1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MAD1L1
Entrez