Recombinant Human M-CSFR/CD115 Protein Summary
| Description |
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 133 - 241 of Mouse Csf1r partial ORF Source: Wheat Germ (in vitro) Amino Acid Sequence:ALKDSVSLMREGGRQVLRKTVYFFSPWRGFIIRKAKVLDSNTYVCKTMVNGRESTSTGIWLKVNRVHPEPPQIKLEPSKLVRIRGEAAQIVCSATNAEVGFNVILKRGD |
Preparation Method |
in vitro wheat germ expression system |
| Source |
Wheat germ |
| Protein/Peptide Type |
Recombinant Protein |
| Gene |
CSF1R |
Applications/Dilutions
| Dilutions |
- ELISA
- Protein Array
- Western Blot
|
| Application Notes |
This product is useful for WB-Re,ELISA,Array,AP. |
Reactivity Notes
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
| Preservative |
No Preservative |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Recombinant Human M-CSFR/CD115 Protein
Background
MCSF Receptor is the receptor for colony stimulating factor 1, a cytokine which controls the production, differentiation, and function of macrophages. This receptor mediates most if not all of the biological effects of this cytokine. Ligand binding activates the receptor kinase through a process of oligomerization and transphosphorylation. The encoded protein is a member of the CSF1/PDGF receptor family of tyrosine protein kinases and contains 5 immunoglobulin like C2 type domains. CD115 is expressed by cells of the monocytic lineage and by progenitor cells. Mutations in this gene have been associated with a predisposition to myeloid malignancy.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Mu
Applications: BA
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, IHC, Simple Western, WB
Species: Hu
Applications: BA
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu
Applications: CyTOF-ready, Flow
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
Species: Av, Hu, Mu, Rt
Applications: CyTOF-ready, Flow-IC, Flow, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: IHC, Simple Western, WB
Species: Hu
Applications: BA
Species: Mu
Applications: ELISA
Species: Mu
Applications: BA
Species: Bv, Ce, ChHa, Hu, Pm, Mu, Rt, RM
Applications: Dual ISH-IHC, Flow-CS, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, ISH, Simple Western, Single-Cell Western, WB
Species: Hu
Applications: Simple Western, WB
Species: Mu
Applications: Dual ISH-IHC, IHC, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Publications for M-CSFR/CD115 Recombinant Protein (P4534) (0)
There are no publications for M-CSFR/CD115 Recombinant Protein (P4534).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for M-CSFR/CD115 Recombinant Protein (P4534) (0)
There are no reviews for M-CSFR/CD115 Recombinant Protein (P4534).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for M-CSFR/CD115 Recombinant Protein (P4534) (0)
Additional M-CSFR/CD115 Products
Research Areas for M-CSFR/CD115 Recombinant Protein (P4534)
Find related products by research area.
|
Blogs on M-CSFR/CD115