M-CSFR/CD115 Recombinant Protein Antigen

Images

 
There are currently no images for M-CSFR/CD115 Recombinant Protein Antigen (NBP1-84532PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

M-CSFR/CD115 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CSF1R.

Source: E. coli

Amino Acid Sequence: NFDVFLQHNNTKLAIPQQSDFHNNRYQKVLTLNLDQVDFQHAGNYSCVASNVQGKHSTSMFFRVVESAYLNLSSEQNLIQEVTVGEGLNLKVMVEAYPGLQGFNWTYLGPFSDHQP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CSF1R
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-84532. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW
31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for M-CSFR/CD115 Recombinant Protein Antigen

  • CD115 antigen
  • CD115
  • c-fms
  • colony stimulating factor 1 receptor
  • CSF1R
  • CSF-1-R
  • CSFR
  • EC 2.7.10.1
  • FMS proto-oncogene
  • FMSFIM2
  • macrophage colony stimulating factor I receptor
  • macrophage colony-stimulating factor 1 receptor
  • McDonough feline sarcoma viral (v-fms) oncogene homolog
  • M-CSF R
  • MCSFR
  • M-CSFR
  • Proto-oncogene c-Fms

Background

MCSF Receptor is the receptor for colony stimulating factor 1, a cytokine which controls the production, differentiation, and function of macrophages. This receptor mediates most if not all of the biological effects of this cytokine. Ligand binding activates the receptor kinase through a process of oligomerization and transphosphorylation. The encoded protein is a member of the CSF1/PDGF receptor family of tyrosine protein kinases and contains 5 immunoglobulin like C2 type domains. CD115 is expressed by cells of the monocytic lineage and by progenitor cells. Mutations in this gene have been associated with a predisposition to myeloid malignancy.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

416-ML
Species: Mu
Applications: BA
203-IL
Species: Hu
Applications: BA
AF1356
Species: Hu, Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, IHC, Simple Western, WB
NB600-302
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, PLA, S-ELISA, Simple Western, WB
7954-GM/CF
Species: Hu
Applications: BA
MAB812
Species: Hu
Applications: CyTOF-ready, Flow
NBP2-50037
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
NB100-56508
Species: Av, Hu, Mu, Rt
Applications: CyTOF-ready, Flow-IC, Flow, IHC,  IHC-P, WB
255-SC
Species: Hu
Applications: BA
AF2685
Species: Hu
Applications: IHC, Simple Western, WB
7954-GM/CF
Species: Hu
Applications: BA
M6000B
Species: Mu
Applications: ELISA
462-TEC
Species: Mu
Applications: BA
NB110-89474
Species: Bv, Ce, ChHa, Hu, Pm, Mu, Rt, RM
Applications: Dual ISH-IHC, Flow-CS, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, ISH, Simple Western, Single-Cell Western, WB
AF5414
Species: Hu
Applications: Simple Western, WB
AF1042
Species: Mu
Applications: Dual ISH-IHC, IHC, WB
NBP2-42388
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB

Publications for M-CSFR/CD115 Recombinant Protein Antigen (NBP1-84532PEP) (0)

There are no publications for M-CSFR/CD115 Recombinant Protein Antigen (NBP1-84532PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for M-CSFR/CD115 Recombinant Protein Antigen (NBP1-84532PEP) (0)

There are no reviews for M-CSFR/CD115 Recombinant Protein Antigen (NBP1-84532PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for M-CSFR/CD115 Recombinant Protein Antigen (NBP1-84532PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional M-CSFR/CD115 Products

Research Areas for M-CSFR/CD115 Recombinant Protein Antigen (NBP1-84532PEP)

Find related products by research area.

Blogs on M-CSFR/CD115

There are no specific blogs for M-CSFR/CD115, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our M-CSFR/CD115 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CSF1R