Lysyl Oxidase Homolog 2/LOXL2 Antibody

Immunocytochemistry/Immunofluorescence: Lysyl Oxidase Homolog 2/LOXL2 Antibody [NBP2-55314] - Staining of human cell line U-2 OS shows localization to nucleoplasm.

Product Discontinued

Lysyl Oxidase Homolog 2/LOXL2 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: CKHTEDVGVVCSDKRIPGFKFDNSLINQIENLNIQVEDIRIRAILSTYRKRTPVMEGYVEVKEGKTWKQI
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: LOXL2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Reactivity Notes

Mouse 87%, Rat 86%

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Lysyl Oxidase Homolog 2/LOXL2 Antibody

• EC 1.4.3
• EC 1.4.3.-
• LOL2
• LOR2
• LOXL2
• Lysyl Oxidase Homolog 2
• lysyl oxidase related 2
• lysyl oxidase-like 2
• Lysyl oxidase-like protein 2
• Lysyl oxidase-related protein 2
• Lysyl oxidase-related protein WS9-14
• WS9-14

Background

LOXL2 encodes a member of the lysyl oxidase gene family. The prototypic member of the family is essential to the biogenesis of connective tissue, encoding an extracellular copper-dependent amine oxidase that catalyses the first step in the formation of crosslinks in collagens and elastin. A highly conserved amino acid sequence at the C-terminus end appears to be sufficient for amine oxidase activity, suggesting that each family member may retain this function. The N-terminus is poorly conserved and may impart additional roles in developmental regulation, senescence, tumor suppression, cell growth control, and chemotaxis to each member of the family. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: LOXL2