Lysozyme Antibody (2Y5E4)

Immunohistochemistry-Paraffin: Lysozyme Antibody (ARQ4974) [NBP3-15338] -Analysis of paraffin-embedded Human stomach using Lysozyme (LYZ) Rabbit mAb at a dilution of 1:400 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunohistochemistry-Paraffin: Lysozyme Antibody (ARQ4974) [NBP3-15338] -Analysis of Lysozyme (LYZ) in paraffin-embedded mouse kidney tissue using Lysozyme (LYZ) Rabbit mAb at a dilution of 1:900 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry-Paraffin: Lysozyme Antibody (ARQ4974) [NBP3-15338] -Analysis of Lysozyme (LYZ) in paraffin-embedded human spleen tissue using Lysozyme (LYZ) Rabbit mAb at a dilution of 1:900 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Western Blot: Lysozyme Antibody (ARQ4974) [NBP3-15338] - analysis of various lysates, using Lysozyme(LYZ) antibody at 1:20000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit. Exposure time: 90s.

Immunohistochemistry: Lysozyme Antibody (2Y5E4) [Lysozyme] - Immunohistochemistry analysis of paraffin-embedded Human spleen tissue using Lysozyme Rabbit mAb at a dilution of 1:4000 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunocytochemistry/ Immunofluorescence: Lysozyme Antibody (2Y5E4) [Lysozyme] - Confocal imaging of paraffin-embedded Mouse small intestine tissue using Lysozyme Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) . DAPI was used for nuclear staining (Blue). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IF staining. Objective: 40x.

Immunocytochemistry/ Immunofluorescence: Lysozyme Antibody (2Y5E4) [Lysozyme] - Confocal imaging of paraffin-embedded Mouse kidney tissue using Lysozyme Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) . DAPI was used for nuclear staining (Blue). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IF staining. Objective: 40x.

Immunocytochemistry/ Immunofluorescence: Lysozyme Antibody (2Y5E4) [Lysozyme] - Confocal imaging of RAW 264.7 cells using Lysozyme Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) . DAPI was used for nuclear staining (Blue). Objective: 100x.

Immunohistochemistry: Lysozyme Antibody (2Y5E4) [Lysozyme] - Immunohistochemistry analysis of paraffin-embedded Mouse spleen tissue using Lysozyme Rabbit mAb at a dilution of 1:4000 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunocytochemistry/ Immunofluorescence: Lysozyme Antibody (2Y5E4) [Lysozyme] - Confocal imaging of paraffin-embedded Mouse lung tissue using Lysozyme Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) . DAPI was used for nuclear staining (Blue). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IF staining. Objective: 40x.

Immunohistochemistry: Lysozyme Antibody (2Y5E4) [Lysozyme] - Immunohistochemistry analysis of paraffin-embedded Human tonsil tissue using Lysozyme Rabbit mAb at a dilution of 1:4000 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunocytochemistry/ Immunofluorescence: Lysozyme Antibody (2Y5E4) [Lysozyme] - Immunofluorescence analysis of paraffin-embedded Human stomach tissue using Lysozyme Rabbit mAb at a dilution of 1:400 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunohistochemistry: Lysozyme Antibody (2Y5E4) [Lysozyme] - Immunohistochemistry analysis of paraffin-embedded Human colon tissue using Lysozyme Rabbit mAb at a dilution of 1:4000 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, ICC/IF, IHC
• Clone: 2Y5E4
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

Lysozyme Antibody (2Y5E4) Summary

• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Lysozyme (NP_000230.1). MKALIVLGLVLLSVTVQGKVFERCELARTLKRLGMDGYRGISLANWMCLAKWESGYNTRATNYNAGDRSTDYGIFQINSRYWCNDGKTPGAVNACHLSCS
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: LYZ
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 ug/mL
  • Immunocytochemistry/ Immunofluorescence 1:200 - 1:2000
  • Immunohistochemistry 1:1000 - 1:10000
  • Immunohistochemistry-Paraffin 1:1000 - 1:10000
  • Western Blot 1:3000 - 1:20000
• Theoretical MW: 17 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.05% Proclin 300
• Purity: Affinity purified

Alternate Names for Lysozyme Antibody (2Y5E4)

• EC 3.2.1.17
• lysozyme (renal amyloidosis)1,4-beta-N-acetylmuramidase C
• lysozyme C
• Lysozyme
• LZM
• renal amyloidosis

Background

Lysozyme catalyzes the hydrolysis of certain mucopolysaccharides of bacterial cell walls. Specifically, it catalyzes the hydrolysis of the bacterial cell wall beta glycosidic linkages between N acetylmuramic acid and N acetylglucosamine. It is found in spleen, lung, kidney, white blood cells, plasma, saliva, milk, and tears.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: LYZ