Recombinant Human LYPLA3 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human LYPLA3 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 314-412 of Human LYPLA3 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:TEGLVEATMPPGVQLHCLYGTGVPTPDSFYYESFPDRDPKICFGDGDGTVNLKSALQCQAWQSRQEHQVLLQELPGSEHIEMLANATTLAYLKRVLLGP

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
PLA2G15

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human LYPLA3 Protein

  • 1-O-acylceramide synthase
  • ACSDKFZp564A0122
  • EC 2.3.1.43
  • GXVPLA2
  • LLPLLCAT-like lysophospholipase
  • LPLA2group XV phospholipase A2
  • LYPLA3EC 2.3.1.-
  • lysophospholipase 3 (lysosomal phospholipase A2)
  • Lysophospholipase 3
  • Lysosomal phospholipase A2
  • phospholipase A2, group XV

Background

LYPLA3 - lysophospholipase 3 (lysosomal phospholipase A2)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-01833
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-90276
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
355-BM/CF
Species: Hu, Mu, Rt
AF5739
Species: Hu, Mu, Rt
Applications: WB
NB100-56561
Species: Hu, Mu, Rt
Applications: WB
AF1513
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
H00051703-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, IP
AF6898
Species: Hu, Mu, Rt
Applications: WB
NB110-99585
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ICC/IF
AF3667
Species: Hu, Mu
Applications: WB, Simple Western, IHC, ICC
NBP2-15139
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
H00023659-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for LYPLA3 Partial Recombinant Protein (H00023659-Q01) (0)

There are no publications for LYPLA3 Partial Recombinant Protein (H00023659-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LYPLA3 Partial Recombinant Protein (H00023659-Q01) (0)

There are no reviews for LYPLA3 Partial Recombinant Protein (H00023659-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LYPLA3 Partial Recombinant Protein (H00023659-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional LYPLA3 Products

Bioinformatics Tool for LYPLA3 Partial Recombinant Protein (H00023659-Q01)

Discover related pathways, diseases and genes to LYPLA3 Partial Recombinant Protein (H00023659-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on LYPLA3

There are no specific blogs for LYPLA3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

LYPLA3 Antibody
NBP1-92088
BMP-2 [Unconjugated]
355-BM-010/CF

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human LYPLA3 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PLA2G15